Protein
MIA_03071_1
Length
153 amino acids
Browser: contig04:160841-161303-
Protein function
EGGNOG: | 0PPJR | FG06905.1 | Inherit from euNOG: mitochondrial cytochrome c oxidase assembly factor |
---|---|---|---|
SGD closest match: | S000002486 | PET100 | Protein PET100, mitochondrial |
CGD closest match: | CAL0000185665 | PET100 | Pet100p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04344_1 | 71.875% | 64 | 8.67e-31 | MCA_04344_1 |
A0A0J9X433_GEOCN | 67.213% | 61 | 2.68e-28 | Similar to Saccharomyces cerevisiae YDR079W PET100 Chaperone that specifically facilitates the assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA02s02474g PE=4 SV=1 |
UniRef50_A0A0J9X433 | 67.213% | 61 | 5.48e-25 | Similar to Saccharomyces cerevisiae YDR079W PET100 Chaperone that specifically facilitates the assembly of cytochrome c oxidase n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X433_GEOCN |
A0A060TCS7_BLAAD | 55.556% | 54 | 2.82e-18 | ARAD1D45430p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45430g PE=4 SV=1 |
PT100_YEAST | 48.333% | 60 | 2.37e-17 | Protein PET100, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET100 PE=1 SV=1 |
A0A1D8PES2_CANAL | 54.717% | 53 | 7.45e-15 | Pet100p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PET100 PE=4 SV=1 |
A0A1E3PFS2_9ASCO | 44.828% | 58 | 1.74e-14 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43270 PE=4 SV=1 |
Q6C7V7_YARLI | 57.143% | 35 | 7.83e-10 | YALI0D24992p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D24992g PE=4 SV=1 |
A0A161HMJ9_9ASCO | 67.742% | 31 | 3.58e-10 | Pet100p OS=Sugiyamaella lignohabitans GN=PET100 PE=4 SV=1 |
A0A1E4TE24_9ASCO | 40.000% | 50 | 9.92e-10 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_99496 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2403
Predicted cleavage: 11
Protein family membership
- Protein Pet100 (IPR018625)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09803 (Pet100)
-

Unintegrated signatures
Protein sequence
>MIA_03071_1 MFRFFKNFRMQGTNLEIMKFAICVTFPIGTMIWVGNDTHEKFNVPNFWPDPSTLHRIPKTPEELQAELARMRAARAEKRA RLEREAQQMSIAAPTPEELEARELEGMKNRIKVRELAEQALRQKEEEEAAAAAAAATAAAEAAAASSVVAGAA
GO term prediction
Biological Process
GO:0033617 mitochondrial respiratory chain complex IV assembly
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion