Protein
MCA_04344_1
Length
114 amino acids
Gene name: PET100
Description: Protein PET100, mitochondrial cytochrome c oxidase assembly factor
Browser: contigC:2759675-2760155+
RNA-seq: read pairs 1519, FPKM 163.2, percentile rank 85.8% (100% = highest expression)
Protein function
| Annotation: | PET100 | Protein PET100, mitochondrial cytochrome c oxidase assembly factor | |
|---|---|---|---|
| KEGG: | K18187 | PET100F | protein PET100, fungi type |
| EGGNOG: | 0PPJR | FG06905.1 | Inherit from euNOG: mitochondrial cytochrome c oxidase assembly factor |
| SGD closest match: | S000002486 | PET100 | Protein PET100, mitochondrial |
| CGD closest match: | CAL0000185665 | PET100 | Pet100p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03071_1 | 71.88% | 64 | 2e-29 | MIA_03071_1 |
| A0A0J9X433_GEOCN | 72.13% | 61 | 2e-29 | Similar to Saccharomyces cerevisiae YDR079W PET100 Chaperone that specifically facilitates the assembly of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA02s02474g PE=4 SV=1 |
| UniRef50_A0A0J9X433 | 72.13% | 61 | 4e-26 | Similar to Saccharomyces cerevisiae YDR079W PET100 Chaperone that specifically facilitates the assembly of cytochrome c oxidase n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X433_GEOCN |
| A0A060TCS7_BLAAD | 63.64% | 55 | 9e-22 | ARAD1D45430p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45430g PE=4 SV=1 |
| PT100_YEAST | 57.89% | 57 | 8e-20 | Protein PET100, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET100 PE=1 SV=1 |
| A0A1E3PFS2_9ASCO | 47.62% | 63 | 3e-16 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43270 PE=4 SV=1 |
| A0A1D8PES2_CANAL | 50.94% | 53 | 5e-14 | Pet100p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PET100 PE=4 SV=1 |
| Q6C7V7_YARLI | 65.71% | 35 | 7e-13 | YALI0D24992p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D24992g PE=4 SV=1 |
| A0A161HMJ9_9ASCO | 77.42% | 31 | 2e-12 | Pet100p OS=Sugiyamaella lignohabitans GN=PET100 PE=4 SV=1 |
| A0A1E4TE24_9ASCO | 36.00% | 50 | 2e-08 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_99496 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1176
Protein family membership
- Protein Pet100 (IPR018625)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09803 (Pet100)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04344_1 MSRFINSIKNFKLQGTNLEIFRFALCVSFPIGAMIWVGNDTHEKLNVPGFWPDPSRLNKIPKDPEELQAELARMRAARLE KKRRLEAEAAALNIKHPEEEQSATSSEIPSTTSA
GO term prediction
Biological Process
GO:0033617 mitochondrial respiratory chain complex IV assembly
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion