Protein
MIA_03051_1
Length
69 amino acids
Browser: contig04:110606-110816+
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01117_1 | 37.500% | 48 | 1.23e-06 | MCA_01117_1 |
| A0A060T7W1_BLAAD | 33.333% | 45 | 2.94e-06 | ARAD1D02640p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D02640g PE=4 SV=1 |
| Q6C3X2_YARLI | 35.714% | 42 | 6.59e-06 | YALI0E31537p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E31537g PE=4 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0491
Protein family membership
- Short coiled-coil protein (IPR019357)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10224 (DUF2205)
-
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_03051_1 MSDSQQSQQQATADTDTQNLKVQAKQLRQRLDDAVEQIRALQNEYSGLTAENKYLEEYIGNILAPASAK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.