Protein
MCA_01117_1
Length
78 amino acids
Browser: contigA:3559906-3560143+
RNA-seq: read pairs 255, FPKM 39.9, percentile rank 60.2% (100% = highest expression)
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A167C2C6_9ASCO | 55.77% | 52 | 1e-14 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3933 PE=4 SV=1 |
UniRef50_A0A167C2C6 | 55.77% | 52 | 3e-11 | Uncharacterized protein n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167C2C6_9ASCO |
A0A060T7W1_BLAAD | 51.92% | 52 | 7e-14 | ARAD1D02640p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D02640g PE=4 SV=1 |
Q6C3X2_YARLI | 54.35% | 46 | 1e-12 | YALI0E31537p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E31537g PE=4 SV=2 |
A0A1E3PNH1_9ASCO | 40.82% | 49 | 4e-08 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_64978 PE=4 SV=1 |
MIA_03051_1 | 37.50% | 48 | 2e-06 | MIA_03051_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0138
Protein family membership
- Short coiled-coil protein (IPR019357)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10224 (DUF2205)
-

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_01117_1 MSSTTDENNHNSSENVDQNDEASLKQMQEQALVLQTSLADILEEIQTVKDETQRLNSENKFLQDYIGNLLSTGNLINK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.