Protein

MIA_03049_1

Length
161 amino acids


Browser: contig04:108185-108729+

Protein function

EGGNOG:0PSDMFG02097.1Glutaredoxin
SGD closest match:S000002921GRX2Glutaredoxin-2, mitochondrial
CGD closest match:CAL0000200475orf19.6509Uncharacterized protein

Protein alignments

%idAln lengthE-value
UniRef50_C5MG8042.735%1171.79e-25Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=C5MG80_CANTT
MCA_05757_140.678%1181.13e-27MCA_05757_1
Q5AH29_CANAL42.241%1161.58e-26Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6509 PE=4 SV=1
A0A0J9X659_GEOCN42.623%1221.10e-24Similar to Saccharomyces cerevisiae YDR513W GRX2 Cytoplasmic glutaredoxin, thioltransferase,glutathione-dependent disulfide oxidoreductase involved in maintaining redox state of target proteins OS=Geotrichum candidum GN=BN980_GECA03s06071g PE=4 SV=1
A0A060T8Z1_BLAAD43.363%1131.23e-24ARAD1C33550p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33550g PE=4 SV=1
A0A1E3PE38_9ASCO38.182%1105.76e-23Glutaredoxin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28651 PE=4 SV=1
GLRX2_YEAST45.679%814.11e-19Glutaredoxin-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX2 PE=1 SV=3
Q6CCY8_YARLI47.945%731.12e-18YALI0C05467p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05467g PE=4 SV=1
A0A167DUM9_9ASCO39.535%864.13e-15Dithiol glutaredoxin GRX2 OS=Sugiyamaella lignohabitans GN=GRX2 PE=4 SV=1
A0A1E4TCR7_9ASCO37.079%893.01e-12Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13921 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8085
Predicted cleavage: 26

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 161

Detailed signature matches

    1. SSF52833 (Thioredox...)
    1. PF00462 (Glutaredoxin)
    2. PS51354 (GLUTAREDOX...)
    1. PR00160 (GLUTAREDOXIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SFLDG00328 (Glutare...)
  2. cd03419 (GRX_GRXh_1...)

Residue annotation

  1. SFLDG00328
  2. catalytic residues...
  3. GSH binding site c...

Protein sequence

>MIA_03049_1
MFKLYRGFSTVVTPGRLIVALEGPDLKKGLDGLIKSNPVFMASKRYVSGENAFNTIVNLFHFDSYCPYCSRAKTLLDLLR
VDYAYIELDHMTNGKEIQDIITDMTGQRTVPSVFIGQRHVGGSSDLAELNVEGKLRGLLENAGAKFLKDAAEEKSNLKTK
I

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis

Molecular Function

GO:0009055 electron carrier activity
GO:0015035 protein disulfide oxidoreductase activity

Cellular Component

None predicted.