Protein
MIA_03018_1
Length
240 amino acids
Browser: contig04:33489-34212-
Protein function
EGGNOG: | 0PJI2 | FG05094.1 | increased sodium tolerance protein 1 |
---|---|---|---|
SGD closest match: | S000005209 | IST1 | Vacuolar protein sorting-associated protein IST1 |
CGD closest match: | CAL0000189621 | IST1 | Ist1p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XL25_GEOCN | 72.093% | 172 | 8.64e-74 | Similar to Saccharomyces cerevisiae YNL265C IST1 Protein with a positive role in the multivesicular body sorting pathway OS=Geotrichum candidum GN=BN980_GECA25s00802g PE=4 SV=1 |
UniRef50_A0A0J9XL25 | 72.093% | 172 | 1.77e-70 | Similar to Saccharomyces cerevisiae YNL265C IST1 Protein with a positive role in the multivesicular body sorting pathway n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XL25_GEOCN |
MCA_05874_1 | 62.304% | 191 | 1.83e-66 | MCA_05874_1 |
Q6CFT5_YARLI | 70.440% | 159 | 6.45e-64 | YALI0B04048p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04048g PE=4 SV=1 |
A0A060TGA7_BLAAD | 66.857% | 175 | 3.59e-64 | ARAD1D21934p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D21934g PE=4 SV=1 |
A0A1E3PDC6_9ASCO | 64.286% | 168 | 6.63e-58 | DUF292-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48128 PE=4 SV=1 |
Q5A7Q7_CANAL | 55.429% | 175 | 3.75e-42 | Ist1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IST1 PE=4 SV=1 |
A0A167C3B5_9ASCO | 48.428% | 159 | 4.28e-41 | Ist1p OS=Sugiyamaella lignohabitans GN=IST1 PE=4 SV=1 |
IST1_YEAST | 47.778% | 180 | 9.75e-31 | Vacuolar protein sorting-associated protein IST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8143
Predicted cleavage: 11
Protein family membership
- Vacuolar protein sorting-associated protein Ist1 (IPR005061)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_03018_1 MPVNPMNSRLKAQLKMAINRLRLVQEKETALAKESRRGLAQLLTDGKEQSARIRVENVIRSDIYVELLEMLELYCELLLA RIGLLEGRDCDAGLEEAVKTIIYAAPRTEIKELSVIREIFVAKFGKEFALEVIEHPEKYVQEKILKRLRVDPPSEELVTL YLKEIAKAYHAPFSELTEEDLKEEEDEENEDETKDDNEGKEKKVKPTKSALPLAARAPPPKKVDKDLDDLQRRFDALRKH
GO term prediction
Biological Process
GO:0015031 protein transport
Molecular Function
None predicted.
Cellular Component
None predicted.