Protein

MIA_03018_1

Length
240 amino acids


Browser: contig04:33489-34212-

Protein function

EGGNOG:0PJI2FG05094.1increased sodium tolerance protein 1
SGD closest match:S000005209IST1Vacuolar protein sorting-associated protein IST1
CGD closest match:CAL0000189621IST1Ist1p

Protein alignments

%idAln lengthE-value
A0A0J9XL25_GEOCN72.093%1728.64e-74Similar to Saccharomyces cerevisiae YNL265C IST1 Protein with a positive role in the multivesicular body sorting pathway OS=Geotrichum candidum GN=BN980_GECA25s00802g PE=4 SV=1
UniRef50_A0A0J9XL2572.093%1721.77e-70Similar to Saccharomyces cerevisiae YNL265C IST1 Protein with a positive role in the multivesicular body sorting pathway n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XL25_GEOCN
MCA_05874_162.304%1911.83e-66MCA_05874_1
Q6CFT5_YARLI70.440%1596.45e-64YALI0B04048p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04048g PE=4 SV=1
A0A060TGA7_BLAAD66.857%1753.59e-64ARAD1D21934p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D21934g PE=4 SV=1
A0A1E3PDC6_9ASCO64.286%1686.63e-58DUF292-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48128 PE=4 SV=1
Q5A7Q7_CANAL55.429%1753.75e-42Ist1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IST1 PE=4 SV=1
A0A167C3B5_9ASCO48.428%1594.28e-41Ist1p OS=Sugiyamaella lignohabitans GN=IST1 PE=4 SV=1
IST1_YEAST47.778%1809.75e-31Vacuolar protein sorting-associated protein IST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8143
Predicted cleavage: 11

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_03018_1
MPVNPMNSRLKAQLKMAINRLRLVQEKETALAKESRRGLAQLLTDGKEQSARIRVENVIRSDIYVELLEMLELYCELLLA
RIGLLEGRDCDAGLEEAVKTIIYAAPRTEIKELSVIREIFVAKFGKEFALEVIEHPEKYVQEKILKRLRVDPPSEELVTL
YLKEIAKAYHAPFSELTEEDLKEEEDEENEDETKDDNEGKEKKVKPTKSALPLAARAPPPKKVDKDLDDLQRRFDALRKH

GO term prediction

Biological Process

GO:0015031 protein transport

Molecular Function

None predicted.

Cellular Component

None predicted.