Protein
MCA_05874_1
Length
296 amino acids
Gene name: IST1
Description: Vacuolar protein sorting-associated protein IST1
Browser: contigD:2607437-2608328+
RNA-seq: read pairs 2194, FPKM 91.3, percentile rank 77.2% (100% = highest expression)
Protein function
Annotation: | IST1 | Vacuolar protein sorting-associated protein IST1 | |
---|---|---|---|
KEGG: | K19476 | IST1 | vacuolar protein sorting-associated protein IST1 |
EGGNOG: | 0PJI2 | FG05094.1 | increased sodium tolerance protein 1 |
SGD closest match: | S000005209 | IST1 | Vacuolar protein sorting-associated protein IST1 |
CGD closest match: | CAL0000189621 | IST1 | Ist1p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03018_1 | 62.11% | 190 | 5e-64 | MIA_03018_1 |
A0A0J9XL25_GEOCN | 60.94% | 192 | 6e-61 | Similar to Saccharomyces cerevisiae YNL265C IST1 Protein with a positive role in the multivesicular body sorting pathway OS=Geotrichum candidum GN=BN980_GECA25s00802g PE=4 SV=1 |
UniRef50_A0A0J9XL25 | 60.94% | 192 | 1e-57 | Similar to Saccharomyces cerevisiae YNL265C IST1 Protein with a positive role in the multivesicular body sorting pathway n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XL25_GEOCN |
A0A060TGA7_BLAAD | 56.25% | 192 | 2e-54 | ARAD1D21934p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D21934g PE=4 SV=1 |
Q6CFT5_YARLI | 57.95% | 176 | 5e-54 | YALI0B04048p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04048g PE=4 SV=1 |
A0A1E3PDC6_9ASCO | 55.43% | 184 | 1e-46 | DUF292-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48128 PE=4 SV=1 |
Q5A7Q7_CANAL | 41.88% | 191 | 9e-35 | Ist1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IST1 PE=4 SV=1 |
IST1_YEAST | 45.83% | 192 | 2e-31 | Vacuolar protein sorting-associated protein IST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST1 PE=1 SV=1 |
A0A167C3B5_9ASCO | 56.82% | 88 | 8e-29 | Ist1p OS=Sugiyamaella lignohabitans GN=IST1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7530
Predicted cleavage: 12
Protein family membership
- Vacuolar protein sorting-associated protein Ist1 (IPR005061)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05874_1 MPPVNPYISRLKAQLKMAINRLKLLEQKQTVTTKDSRRQMAQLLTDGKEQSAKIRVENIIRMDINIELLEILELYCELLL ARIGLLDTTYSASLLGSDSAKSQASRECDDGLKEAVWAIIYTAPKVPEIKELWNLRELFIAKYGKDFAKQVIDNPDEHLP ERLLKKLSIEPPSQELVSLYLKEIAKAYNAPFSELSDEEVEEDLGEEDDDDDEDGGNAGEKVELTESAIPSFPTIPKTPA GISASKPAKPAQKPVAAAPKPVPKKVVTAAPAVPKSKADQEFEDLQKRFEALRRIN
GO term prediction
Biological Process
GO:0015031 protein transport
Molecular Function
None predicted.
Cellular Component
None predicted.