Protein
MIA_02957_1
Length
308 amino acids
Browser: contig03:2184519-2185446-
Protein function
| EGGNOG: | 0PFP4 | FG04126.1 | Catalyzes the oxidation of uric acid to 5- hydroxyisourate, which is further processed to form (S)-allantoin (By similarity) |
|---|---|---|---|
| CGD closest match: | CAL0000195364 | orf19.2114 | Uricase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XGW8_GEOCN | 66.230% | 305 | 2.72e-148 | Uricase OS=Geotrichum candidum GN=BN980_GECA16s02727g PE=3 SV=1 |
| MCA_02789_1 | 66.000% | 300 | 6.51e-147 | MCA_02789_1 |
| L8BT20_BLAAD | 61.639% | 305 | 2.79e-131 | Uricase OS=Blastobotrys adeninivorans GN=uox PE=3 SV=1 |
| A0A161HMG7_9ASCO | 62.500% | 304 | 5.93e-131 | Uricase OS=Sugiyamaella lignohabitans GN=AWJ20_2522 PE=3 SV=1 |
| UniRef50_P78609 | 55.229% | 306 | 1.70e-116 | Uricase n=65 Tax=Saccharomycetales TaxID=4892 RepID=URIC_CYBJA |
| A0A1E3PPW7_9ASCO | 53.465% | 303 | 1.59e-119 | Uricase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45571 PE=3 SV=1 |
| Q6C2B4_YARLI | 55.627% | 311 | 4.22e-117 | Uricase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F09251g PE=3 SV=1 |
| Q5ACV3_CANAL | 51.656% | 302 | 4.98e-103 | Uricase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2114 PE=3 SV=1 |
| A0A1E4TA39_9ASCO | 50.842% | 297 | 1.28e-101 | Uricase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45103 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1480
Protein family membership
- Uricase (IPR002042)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
PF01014 (Uricase)
-
PR00093 (URICASE)
-
PIRSF000241 (Urate_...)
-
-
-
PS00366 (URICASE)
-
no IPR
Unintegrated signatures
-
-
-
SSF55620 (Tetrahydr...)
Protein sequence
>MIA_02957_1 MSSSAYLASNTYGKDNVRLLKVAKDPVDASVQHVIELTVQVLLEGDLEIAYTKADNAPVVPTDTVKNTIYVLAKQSSTWP IERFGATLTNHFVTKYDHISKATALIKQHRWTRYAVDGKPHNHSFIQDGRELRTAKVQKTKTGAFVIESGIKDLTVLKST GSQFWGYNKCEYTTLEETYDRILSTDVDAVWTWNGTRFANIRDVDYTADSGVFDSVYDTARNTTLRTFALENSASVQATM YNISEEIIQKAPLVDQVYFALPNKHYVAANLEWFQNTQNKGKDAEVYVPLSDPNGLIKSVVRRRTSKL
GO term prediction
Biological Process
GO:0006144 purine nucleobase metabolic process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004846 urate oxidase activity
Cellular Component
None predicted.