Protein
MCA_02789_1
Length
309 amino acids
Browser: contigB:2383728-2384658-
RNA-seq: read pairs 4310, FPKM 171.8, percentile rank 86.4% (100% = highest expression)
Protein function
KEGG: | K00365 | uaZ | urate oxidase [EC:1.7.3.3] |
---|---|---|---|
EGGNOG: | 0PFP4 | FG04126.1 | Catalyzes the oxidation of uric acid to 5- hydroxyisourate, which is further processed to form (S)-allantoin (By similarity) |
CGD closest match: | CAL0000195364 | orf19.2114 | Uricase |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XGW8_GEOCN | 66.78% | 304 | 1e-145 | Uricase OS=Geotrichum candidum GN=BN980_GECA16s02727g PE=3 SV=1 |
MIA_02957_1 | 66.00% | 300 | 4e-145 | MIA_02957_1 |
A0A161HMG7_9ASCO | 63.93% | 305 | 3e-141 | Uricase OS=Sugiyamaella lignohabitans GN=AWJ20_2522 PE=3 SV=1 |
L8BT20_BLAAD | 63.82% | 304 | 2e-140 | Uricase OS=Blastobotrys adeninivorans GN=uox PE=3 SV=1 |
UniRef50_P78609 | 62.50% | 304 | 1e-127 | Uricase n=65 Tax=Saccharomycetales TaxID=4892 RepID=URIC_CYBJA |
Q6C2B4_YARLI | 60.91% | 307 | 2e-128 | Uricase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F09251g PE=3 SV=1 |
A0A1E3PPW7_9ASCO | 57.00% | 300 | 2e-118 | Uricase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45571 PE=3 SV=1 |
Q5ACV3_CANAL | 54.90% | 306 | 9e-110 | Uricase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2114 PE=3 SV=1 |
A0A1E4TA39_9ASCO | 50.96% | 312 | 2e-104 | Uricase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45103 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0829
Protein family membership
- Uricase (IPR002042)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
PF01014 (Uricase)
-
PR00093 (URICASE)
-
PIRSF000241 (Urate_...)
-
-
-
PS00366 (URICASE)
-
no IPR
Unintegrated signatures
-
-
-
SSF55620 (Tetrahydr...)
Protein sequence
>MCA_02789_1 MSEFKLAYSTYGKDNVRVLKVWKDPKNPQIQNVIEMTVRCLLEGDVEESYTKADNSPIVPTDTVKNTVYVLAKQTDTWPI ERFASTLANHFITRYSHIHGANVYIKQHRWTKYAVNGKLHPHSFIQDGRELRTCEVYKKSETSPFVITSGIKDLTVLKST GSMFYDFHRCEYTTLKDTKDRILSTDVDATWVWNPAKFNKLEDVYAYADKGIFDTVYNQARTITLNTFALENSASVQATM YNISTEILSVAPDVEFVNYALPNKHYMNIDLSWHKGIKNLGKDQEVFLPSSDPNGLIKSTVTRSSKAKL
GO term prediction
Biological Process
GO:0006144 purine nucleobase metabolic process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004846 urate oxidase activity
Cellular Component
None predicted.