Protein
MIA_02951_1
Length
217 amino acids
Browser: contig03:2171890-2172747+
Protein function
EGGNOG: | 0PK6X | TVP23 | Golgi membrane protein involved in vesicular trafficking (By similarity) |
---|---|---|---|
SGD closest match: | S000002491 | TVP23 | Golgi apparatus membrane protein TVP23 |
CGD closest match: | CAL0000197417 | TVP23 | Golgi apparatus membrane protein TVP23 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_06516_1 | 69.634% | 191 | 7.17e-78 | MCA_06516_1 |
A0A060TJ97_BLAAD | 60.000% | 210 | 2.05e-68 | Golgi apparatus membrane protein TVP23 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45474g PE=3 SV=1 |
A0A0J9XBY5_GEOCN | 69.792% | 192 | 4.15e-67 | Golgi apparatus membrane protein TVP23 OS=Geotrichum candidum GN=BN980_GECA09s03222g PE=3 SV=1 |
TVP23_YARLI | 63.736% | 182 | 4.36e-63 | Golgi apparatus membrane protein TVP23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TVP23 PE=3 SV=1 |
UniRef50_W1QC75 | 61.538% | 182 | 9.31e-60 | Golgi apparatus membrane protein TVP23 n=7 Tax=Saccharomycetales TaxID=4892 RepID=W1QC75_OGAPD |
TVP23_CANAL | 50.463% | 216 | 3.29e-54 | Golgi apparatus membrane protein TVP23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TVP23 PE=3 SV=1 |
A0A1E3PH45_9ASCO | 53.431% | 204 | 2.43e-53 | Golgi apparatus membrane protein TVP23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43269 PE=3 SV=1 |
A0A1E4THS3_9ASCO | 52.514% | 179 | 1.26e-43 | Golgi apparatus membrane protein TVP23 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_52168 PE=3 SV=1 |
TVP23_YEAST | 36.310% | 168 | 7.40e-21 | Golgi apparatus membrane protein TVP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP23 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5972
Predicted cleavage: 109
Protein family membership
- Protein of unknown function DUF846, eukaryotic (IPR008564)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_02951_1 MVCPIALSTKNTLCVLSSTLPVTQPDVTTPAQQQPRTLFQRLSESSHPVALLFFLFFRLSALFIYIFGTLFTSNKVLLFV IIILLLAADFWNVKNVSGRLLVGLRWWNESAQDGSTIWVFETADPQRYINPIDSKVFWLLSYVTPIAWVVLILFKLSFIW LLLTVIALILSITNAVAFSRCDKFAKASLVTSGFMGSVSTGLLTRAFGSVAGRFFNR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane