Protein
MCA_06516_1
Length
183 amino acids
Gene name: TVP23
Description: Golgi apparatus membrane protein TVP23
Browser: contigD:4459579-4460481-
RNA-seq: read pairs 1292, FPKM 86.8, percentile rank 76.6% (100% = highest expression)
Protein function
| Annotation: | TVP23 | Golgi apparatus membrane protein TVP23 | |
|---|---|---|---|
| EGGNOG: | 0PK6X | TVP23 | Golgi membrane protein involved in vesicular trafficking (By similarity) |
| SGD closest match: | S000002491 | TVP23 | Golgi apparatus membrane protein TVP23 |
| CGD closest match: | CAL0000197417 | TVP23 | Golgi apparatus membrane protein TVP23 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02951_1 | 70.16% | 191 | 4e-68 | MIA_02951_1 |
| A0A0J9XBY5_GEOCN | 64.10% | 195 | 7e-55 | Golgi apparatus membrane protein TVP23 OS=Geotrichum candidum GN=BN980_GECA09s03222g PE=3 SV=1 |
| A0A060TJ97_BLAAD | 53.17% | 205 | 1e-49 | Golgi apparatus membrane protein TVP23 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45474g PE=3 SV=1 |
| UniRef50_W1QC75 | 53.80% | 184 | 1e-42 | Golgi apparatus membrane protein TVP23 n=7 Tax=Saccharomycetales TaxID=4892 RepID=W1QC75_OGAPD |
| TVP23_YARLI | 53.55% | 183 | 2e-41 | Golgi apparatus membrane protein TVP23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TVP23 PE=3 SV=1 |
| A0A1E3PH45_9ASCO | 57.36% | 129 | 2e-36 | Golgi apparatus membrane protein TVP23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43269 PE=3 SV=1 |
| TVP23_CANAL | 43.38% | 219 | 7e-35 | Golgi apparatus membrane protein TVP23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TVP23 PE=3 SV=1 |
| A0A1E4THS3_9ASCO | 51.61% | 124 | 2e-32 | Golgi apparatus membrane protein TVP23 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_52168 PE=3 SV=1 |
| TVP23_YEAST | 40.18% | 112 | 3e-12 | Golgi apparatus membrane protein TVP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP23 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0274
Predicted cleavage: 76
Protein family membership
- Protein of unknown function DUF846, eukaryotic (IPR008564)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_06516_1 MSIYYEIPAPATQSQPQTRSLFQRLSESSHPIALLFFLFFRIVLIFVIVILLLAADFWNVKNVSGRLLVGLRWWNESTAD GNSIWVFETADPQRYINPIDSKVFWLLSYITPVAWFVLIFFKLSFIWLLLTGIALLLTITNAVAFSRCDKFAKASMVTSG LMGSVSSNIVSKVFGGLAGRIFR
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane