Protein

MCA_06516_1

Length
183 amino acids

Gene name: TVP23

Description: Golgi apparatus membrane protein TVP23

Browser: contigD:4459579-4460481-

RNA-seq: read pairs 1292, FPKM 86.8, percentile rank 76.6% (100% = highest expression)

Protein function

Annotation:TVP23Golgi apparatus membrane protein TVP23
EGGNOG:0PK6XTVP23Golgi membrane protein involved in vesicular trafficking (By similarity)
SGD closest match:S000002491TVP23Golgi apparatus membrane protein TVP23
CGD closest match:CAL0000197417TVP23Golgi apparatus membrane protein TVP23

Protein alignments

%idAln lengthE-value
MIA_02951_170.16%1914e-68MIA_02951_1
A0A0J9XBY5_GEOCN64.10%1957e-55Golgi apparatus membrane protein TVP23 OS=Geotrichum candidum GN=BN980_GECA09s03222g PE=3 SV=1
A0A060TJ97_BLAAD53.17%2051e-49Golgi apparatus membrane protein TVP23 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45474g PE=3 SV=1
UniRef50_W1QC7553.80%1841e-42Golgi apparatus membrane protein TVP23 n=7 Tax=Saccharomycetales TaxID=4892 RepID=W1QC75_OGAPD
TVP23_YARLI53.55%1832e-41Golgi apparatus membrane protein TVP23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TVP23 PE=3 SV=1
A0A1E3PH45_9ASCO57.36%1292e-36Golgi apparatus membrane protein TVP23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43269 PE=3 SV=1
TVP23_CANAL43.38%2197e-35Golgi apparatus membrane protein TVP23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TVP23 PE=3 SV=1
A0A1E4THS3_9ASCO51.61%1242e-32Golgi apparatus membrane protein TVP23 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_52168 PE=3 SV=1
TVP23_YEAST40.18%1123e-12Golgi apparatus membrane protein TVP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TVP23 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0274
Predicted cleavage: 76

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR008564
    Protein of unknown function DUF846, eukaryotic
    1. PF05832 (DUF846)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_06516_1
MSIYYEIPAPATQSQPQTRSLFQRLSESSHPIALLFFLFFRIVLIFVIVILLLAADFWNVKNVSGRLLVGLRWWNESTAD
GNSIWVFETADPQRYINPIDSKVFWLLSYITPVAWFVLIFFKLSFIWLLLTGIALLLTITNAVAFSRCDKFAKASMVTSG
LMGSVSSNIVSKVFGGLAGRIFR

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0016021 integral component of membrane