Protein

MIA_02868_1

Length
327 amino acids

Browser: contig03:1962598-1963683+

Protein function

EGGNOG:0PG12GET3ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail- anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting (By similarity)
SGD closest match:S000002258GET3ATPase GET3
CGD closest match:CAL0000195169GET3ATPase GET3

Protein alignments

%idAln lengthE-value
MCA_02638_181.595%3260.0MCA_02638_1
A0A0J9X687_GEOCN83.019%3180.0ATPase GET3 OS=Geotrichum candidum GN=GET3 PE=3 SV=1
A0A167EBW2_9ASCO76.380%3261.10e-177ATPase GET3 OS=Sugiyamaella lignohabitans GN=GET3 PE=3 SV=1
UniRef50_A0A167EBW276.380%3263.01e-174ATPase GET3 n=8 Tax=Eukaryota TaxID=2759 RepID=A0A167EBW2_9ASCO
A0A060SYF0_BLAAD75.389%3216.85e-170ATPase GET3 OS=Blastobotrys adeninivorans GN=GET3 PE=3 SV=1
GET3_YARLI74.684%3163.88e-169ATPase GET3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET3 PE=3 SV=1
A0A1E3PSQ6_9ASCO74.923%3233.76e-168ATPase GET3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=GET3 PE=3 SV=1
A0A1E4TH41_9ASCO66.561%3141.17e-144ATPase GET3 OS=Tortispora caseinolytica NRRL Y-17796 GN=GET3 PE=3 SV=1
GET3_CANAL58.065%3411.67e-126ATPase GET3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET3 PE=3 SV=1
GET3_YEAST52.754%3451.30e-115ATPase GET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET3 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2348

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 327

Detailed signature matches

  1. Family IPR016300
    Arsenical pump ATPase, ArsA/GET3
    1. cd02035 (ArsA)
    2. TIGR00345
  2. Family IPR027542
    Arsenical pump ATPase, ArsA/GET3, eukaryotic
    1. MF_03112 (Asna1_Get3)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR025723
    Anion-transporting ATPase-like domain
    1. PF02374 (ArsA_ATPase)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...

Residue annotation

  1. Switch I cd02035
  2. Nucleotide binding...
  3. DTAP/Switch II cd0...

Protein sequence

>MIA_02868_1
MSETLEPTLQNIIDQKSLRWIFVGGKGGVGKTTNSCSLAVQLAQHRESVLLISTDPAHNLSDAFDQKFGKDPRAVEGIPN
LFCMEIDPNGAMQELIEQNAGNSAAGNPINSLMQDIAYSIPGVDEAMSFAEVMKQVKSTSFSTIVFDTAPTGHTLRFLSF
PSVLEKALGKISEISGMYGPMLNTLMGSAGANTNINDLMTKLNETRETIAEVNSQFKNPDLTTFVCVCIAEFLSLYETER
MIQELTSYEIDTHCIIVNQLLYPKKGSNCEQCNARHKIQQKYLEQILELYEDFHIVKLPQLTSEVRGAAALKEFSKMLIT
PYVPKDQ

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005524 ATP binding
GO:0016887 ATPase activity

Cellular Component

None predicted.