Protein
MIA_02857_1
Length
137 amino acids
Browser: contig03:1935926-1936423-
Protein function
| EGGNOG: | 0PRUY | DAD1 | Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore |
|---|---|---|---|
| SGD closest match: | S000002423 | DAD1 | DASH complex subunit DAD1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XJG6_GEOCN | 77.966% | 59 | 8.19e-18 | Similar to Saccharomyces cerevisiae YDR016C DAD1 Essential subunit of the Dam1 complex (Aka DASH complex),couples kinetochores to the force produced by MT depolymerization OS=Geotrichum candidum GN=BN980_GECA23s00796g PE=4 SV=1 |
| UniRef50_A0A0J9XJG6 | 77.966% | 59 | 1.67e-14 | Similar to Saccharomyces cerevisiae YDR016C DAD1 Essential subunit of the Dam1 complex (Aka DASH complex),couples kinetochores to the force produced by MT depolymerization n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJG6_GEOCN |
| MCA_05202_1 | 70.492% | 61 | 1.11e-17 | MCA_05202_1 |
| A0A1E3PI93_9ASCO | 50.000% | 64 | 2.24e-08 | DASH complex subunit DAD1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51619 PE=4 SV=1 |
| DAD1_YEAST | 48.148% | 54 | 2.52e-06 | DASH complex subunit DAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAD1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0289
Protein family membership
- DASH complex subunit Dad1 (IPR013958)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF08649 (DASH_Dad1)
-
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_02857_1 MDAQKSNDDGFSITSQKFHSADLDIDSSKAALESNNISGSEIKSPFEHERDILVSQITESMNNVLNNLNALNRALEGVVE VGKEFESISTLWNNYYDGMARVQIQQQQQQQQAQEEQDNAIIENNNEQQPGMRDHSS
GO term prediction
Biological Process
GO:0030472 mitotic spindle organization in nucleus
Molecular Function
None predicted.
Cellular Component
GO:0042729 DASH complex
GO:0072686 mitotic spindle