Protein

MCA_05202_1

Length
104 amino acids


Gene name: DAD1

Description: DASH complex subunit DAD1

Browser: contigD:615373-615745-

RNA-seq: read pairs 437, FPKM 51.4, percentile rank 66.1% (100% = highest expression)

Protein function

Annotation:DAD1DASH complex subunit DAD1
KEGG:K11553DAD1 DASH complex subunit DAD1
EGGNOG:0PRUYDAD1Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore
SGD closest match:S000002423DAD1DASH complex subunit DAD1
CGD closest match:CAL0000195552DAD1Dad1p

Protein alignments

%idAln lengthE-value
UniRef50_F2R0G553.97%632e-18DASH complex subunit n=2 Tax=Komagataella phaffii TaxID=460519 RepID=F2R0G5_KOMPC
A0A0J9XJG6_GEOCN72.13%618e-21Similar to Saccharomyces cerevisiae YDR016C DAD1 Essential subunit of the Dam1 complex (Aka DASH complex),couples kinetochores to the force produced by MT depolymerization OS=Geotrichum candidum GN=BN980_GECA23s00796g PE=4 SV=1
MIA_02857_170.49%615e-17MIA_02857_1
A0A1E3PI93_9ASCO47.27%556e-16DASH complex subunit DAD1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51619 PE=4 SV=1
DAD1_YEAST48.15%541e-11DASH complex subunit DAD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAD1 PE=1 SV=1
A0A1D8PFP9_CANAL46.30%541e-11Dad1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DAD1 PE=4 SV=1
DAD1_YARLI39.29%562e-09DASH complex subunit DAD1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAD1 PE=3 SV=1
A0A1E4TAD0_9ASCO37.74%531e-09Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_19183 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0388

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF08649 (DASH_Dad1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05202_1
MSSEFQNERDLLISEIAISMNSILNNLNTLNRSLEGIVEVGKEFEGISMLWNNYFDGMARVDIEEQKMELLRQQELNNEN
FNDNEEKDEMDTDTTTKVKREPEC

GO term prediction

Biological Process

GO:0030472 mitotic spindle organization in nucleus

Molecular Function

None predicted.

Cellular Component

GO:0042729 DASH complex
GO:0072686 mitotic spindle