Protein

MIA_02810_1

Length
783 amino acids

Browser: contig03:1817251-1819690-

Protein function

EGGNOG:0PK4QKU80Single stranded DNA-dependent ATP-dependent helicase. Involved in non-homologous end joining (NHEJ) DNA double strand break repair. DNA-binding is sequence-independent but has a high affinity to nicks in double stranded DNA and to the ends of duplex DNA. Binds to naturally occurring chromosomal ends, and therefore provides chromosomal end protection. Required also for telomere recombination to repair telomeric ends in the absence of telomerase. ku70, of the ku70 ku80 heterodimer, binds to the stem loop of tlc1, the RNA component of telomerase. Involved in telomere maintenance. Interacts with telomeric repeats and subtelomeric sequences thereby controlling telomere length and protecting against subtelomeric rearrangement. Maintains telomeric chromatin, which is involved in silencing the expression of genes located at the telomere. Required for mating-type switching (By similarity)
CGD closest match:CAL0000183388YKU80ATP-dependent DNA helicase

Protein alignments

%idAln lengthE-value
MCA_04472_130.673%8027.32e-82MCA_04472_1
A0A0J9X5D8_GEOCN30.033%6061.72e-61Similar to Saccharomyces cerevisiae YMR106C YKU80 Subunit of the telomeric Ku complex (Yku70p-Yku80p) OS=Geotrichum candidum GN=BN980_GECA03s00791g PE=4 SV=1
UniRef50_A0A0J9X5D830.033%6063.52e-58Similar to Saccharomyces cerevisiae YMR106C YKU80 Subunit of the telomeric Ku complex (Yku70p-Yku80p) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5D8_GEOCN
KU80_YARLI30.015%6631.41e-51ATP-dependent DNA helicase II subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KU80 PE=3 SV=1
A0A060TCM3_BLAAD24.856%6961.90e-25ARAD1D37246p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D37246g PE=4 SV=1
A0A1E3PQT8_9ASCO24.507%6081.65e-24SPOC domain-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_76203 PE=4 SV=1
A0A167EC69_9ASCO24.845%4833.38e-13Yku80p OS=Sugiyamaella lignohabitans GN=YKU80 PE=4 SV=1
A0A1D8PSH5_CANAL25.416%4213.02e-11ATP-dependent DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YKU80 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0644

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 700 783

Detailed signature matches

  1. Domain IPR002035
    von Willebrand factor, type A
    1. SSF53300 (vWA-like)
    2. G3DSA:3.40.50...
  2. Domain IPR005161
    Ku70/Ku80, N-terminal alpha/beta
    1. PF03731 (Ku_N)
  3. Domain IPR016194
    SPOC-like, C-terminal domain
    1. SSF100939 (SPOC dom...)
    2. G3DSA:2.40.29...
  4. Domain IPR006164
    Ku70/Ku80 beta-barrel domain
    1. PF02735 (Ku)
    2. SM00559 (ku_4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.16...
  2. mobidb-lite (disord...)

Protein sequence

>MIA_02810_1
MSKEVTVFVIDLHSSMGKSHNGRLESDLQWAMQYVYDVIADKVLSQRKTDCVGIVGYNGFGIDKILYPIKQFFLQDIHAL
RESLNPTKDTHDVKKNGLLEAIFTGLGMIIDYTKKNKYIRNLVIVTNARGPGINPTDSAMDMISKHLIDHEINFKVVGID
FSQGSETVSHNPHKAHNEKVFREIANKIPERLAVVGTAEEAIQRTCRPVAKRTIATKKYSGLLTLGDVITHEFGDDTVSI
PIDVYTGTRATPPISATATTAKMFKRDETKDNGTELCQVSFATEYYVDDGKGGEKLVFLDEDQSDAEVVHKREQGYRVGS
ELVVLGDHETEQLMETASGLNLQTIPGGSSRMLEMVGFMPYDTVPRWMGTSGVEYVLPGKNSMSAPAALASFVRALYETD
SVALVRANASGGRGAAGGGGATSSNPPGLGDSAATVSVLRGGPEMRVLVPHITEACEMFVSVRLPFSDDVRPYGFAPIGF
SVDRASQEAVFKGQNVPSEEMQDAMDAFVDAMDVTEDGAMFEGEATEWGVPEDIVNPLVHRLKQVVKYVGIYGKPGQPLE
KMPPIPSGLLEYSEPPVEAATRAAAGPASRLEKAFKVTKALSKSERNKALRGSDRDLSRPVAASEALDLEGLLAGTWVPK
SSNQNGEGSTSQKKQSEAVGKEEKEGGGHEQPFKAKGTFEEEYEKLERNMMVSGIAPEAKYAAAVLLFDFLAAWGSELEE
LRGLAAVSSRAREQAGELCKKMEKAVSRVVALDLSGMTNQERVEDERKDLAPWMDDFKREFMS

GO term prediction

Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining

Molecular Function

GO:0003677 DNA binding

Cellular Component

None predicted.