Protein
MIA_02803_1
Length
295 amino acids
Browser: contig03:1794798-1795686+
Protein function
| EGGNOG: | 0PN98 | SRB5 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
|---|---|---|---|
| SGD closest match: | S000003336 | SRB5 | Mediator of RNA polymerase II transcription subunit 18 |
| CGD closest match: | CAL0000197175 | SRB5 | Mediator of RNA polymerase II transcription subunit 18 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01434_1 | 41.593% | 339 | 1.84e-79 | MCA_01434_1 |
| A0A1E3PD46_9ASCO | 43.051% | 295 | 5.08e-75 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53602 PE=4 SV=1 |
| UniRef50_A0A1E3PD46 | 43.051% | 295 | 1.38e-71 | Uncharacterized protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PD46_9ASCO |
| A0A167C521_9ASCO | 38.312% | 308 | 3.34e-66 | Mediator of RNA polymerase II transcription subunit 18 OS=Sugiyamaella lignohabitans GN=AWJ20_4027 PE=4 SV=1 |
| A0A060T6W8_BLAAD | 40.741% | 297 | 1.74e-65 | ARAD1C16940p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16940g PE=4 SV=1 |
| MED18_YARLI | 34.021% | 291 | 8.91e-56 | Mediator of RNA polymerase II transcription subunit 18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB5 PE=3 SV=1 |
| A0A0J9XGD7_GEOCN | 34.915% | 295 | 4.64e-49 | Similar to Saccharomyces cerevisiae YGR104C SRB5 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA15s00527g PE=4 SV=1 |
| MED18_YEAST | 23.009% | 339 | 6.42e-15 | Mediator of RNA polymerase II transcription subunit 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB5 PE=1 SV=1 |
| MED18_CANAL | 28.481% | 158 | 7.64e-11 | Mediator of RNA polymerase II transcription subunit 18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB5 PE=3 SV=1 |
| A0A1E4TFC0_9ASCO | 35.593% | 59 | 3.17e-06 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_44125 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0116
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
250
295
Detailed signature matches
Protein sequence
>MIA_02803_1 MPQQLSLYASLPDSELKITLQTLSSIAGMPPQSFLEHSLLWAPKHPYVPVLSAGQVNQIEQYRIRVACDLIALSEEENEN NDRRLPSTSKATADPDYAVKRAVMPYADLSAHATLATRPWSLTVAELPEAGKLSVISQSLLTVSPRVSSGDHTPFEFLDK LGYTFRTEYWTKGYQFVHGNVVVRIFRLCGFDSHAYKNELEQIIEAEQTEQPPGTTARAATEAAKEEVLGGDFLRLLDST KRWTMVALINVESITDLDAIARATAELERFRADVAGLVDLELPERNSFDTRIKRR
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex