Protein

MIA_02803_1

Length
295 amino acids


Browser: contig03:1794798-1795686+

Protein function

EGGNOG:0PN98SRB5Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
SGD closest match:S000003336SRB5Mediator of RNA polymerase II transcription subunit 18
CGD closest match:CAL0000197175SRB5Mediator of RNA polymerase II transcription subunit 18

Protein alignments

%idAln lengthE-value
MCA_01434_141.593%3391.84e-79MCA_01434_1
A0A1E3PD46_9ASCO43.051%2955.08e-75Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53602 PE=4 SV=1
UniRef50_A0A1E3PD4643.051%2951.38e-71Uncharacterized protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PD46_9ASCO
A0A167C521_9ASCO38.312%3083.34e-66Mediator of RNA polymerase II transcription subunit 18 OS=Sugiyamaella lignohabitans GN=AWJ20_4027 PE=4 SV=1
A0A060T6W8_BLAAD40.741%2971.74e-65ARAD1C16940p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16940g PE=4 SV=1
MED18_YARLI34.021%2918.91e-56Mediator of RNA polymerase II transcription subunit 18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB5 PE=3 SV=1
A0A0J9XGD7_GEOCN34.915%2954.64e-49Similar to Saccharomyces cerevisiae YGR104C SRB5 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA15s00527g PE=4 SV=1
MED18_YEAST23.009%3396.42e-15Mediator of RNA polymerase II transcription subunit 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB5 PE=1 SV=1
MED18_CANAL28.481%1587.64e-11Mediator of RNA polymerase II transcription subunit 18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB5 PE=3 SV=1
A0A1E4TFC0_9ASCO35.593%593.17e-06Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_44125 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0116

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 295

Detailed signature matches

Protein sequence

>MIA_02803_1
MPQQLSLYASLPDSELKITLQTLSSIAGMPPQSFLEHSLLWAPKHPYVPVLSAGQVNQIEQYRIRVACDLIALSEEENEN
NDRRLPSTSKATADPDYAVKRAVMPYADLSAHATLATRPWSLTVAELPEAGKLSVISQSLLTVSPRVSSGDHTPFEFLDK
LGYTFRTEYWTKGYQFVHGNVVVRIFRLCGFDSHAYKNELEQIIEAEQTEQPPGTTARAATEAAKEEVLGGDFLRLLDST
KRWTMVALINVESITDLDAIARATAELERFRADVAGLVDLELPERNSFDTRIKRR

GO term prediction

Biological Process

GO:0006357 regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex