Protein
MCA_01434_1
Length
323 amino acids
Gene name: SRB5
Description: Mediator of RNA polymerase II transcription subunit 18
Browser: contigA:4445168-4446140-
RNA-seq: read pairs 516, FPKM 19.7, percentile rank 41.0% (100% = highest expression)
Protein function
| Annotation: | SRB5 | Mediator of RNA polymerase II transcription subunit 18 | |
|---|---|---|---|
| KEGG: | K15136 | SRB5 | mediator of RNA polymerase II transcription subunit 18, fungi type |
| EGGNOG: | 0PN98 | SRB5 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
| SGD closest match: | S000003336 | SRB5 | Mediator of RNA polymerase II transcription subunit 18 |
| CGD closest match: | CAL0000197175 | SRB5 | Mediator of RNA polymerase II transcription subunit 18 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02803_1 | 41.59% | 339 | 2e-71 | MIA_02803_1 |
| A0A1E3PD46_9ASCO | 37.38% | 321 | 3e-55 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53602 PE=4 SV=1 |
| UniRef50_A0A1E3PD46 | 37.38% | 321 | 7e-52 | Uncharacterized protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PD46_9ASCO |
| MED18_YARLI | 42.68% | 164 | 9e-39 | Mediator of RNA polymerase II transcription subunit 18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB5 PE=3 SV=1 |
| A0A0J9XGD7_GEOCN | 45.57% | 158 | 3e-38 | Similar to Saccharomyces cerevisiae YGR104C SRB5 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA15s00527g PE=4 SV=1 |
| A0A167C521_9ASCO | 34.74% | 190 | 8e-33 | Mediator of RNA polymerase II transcription subunit 18 OS=Sugiyamaella lignohabitans GN=AWJ20_4027 PE=4 SV=1 |
| A0A060T6W8_BLAAD | 32.86% | 213 | 4e-32 | ARAD1C16940p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16940g PE=4 SV=1 |
| MED18_CANAL | 34.71% | 121 | 1e-12 | Mediator of RNA polymerase II transcription subunit 18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB5 PE=3 SV=1 |
| MED18_YEAST | 25.37% | 339 | 5e-10 | Mediator of RNA polymerase II transcription subunit 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB5 PE=1 SV=1 |
| A0A1E4TFC0_9ASCO | 30.37% | 135 | 8e-09 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_44125 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0777
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
250
323
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_01434_1 MPQQLSLYSTLSNADLIITLHTLSSLTGMSPFPLLEHSLIWEPKHPYKPVLLAGQVNQIEQYRIILTNDMVKIPVKVADR MQQKPNEKENNDDPMDLDPSSNERENSTTFNFSALTKRRREKFDTILDSQNYVNINFEELALKSLVLSYTDTTPISKHEL KLREWNFNIYEQPEGGKRTVISQSILSSSPEPNENWDPFEFIDKLGYVYKNEYWVKGYQFIYGNIVLRIFRLCRYASPNT KEAIITNSKSQVNQNLDNEHTLVLLDPSQRWTVKAYIDVGSITDLDGINKATQELEALKNGLVGLLDLELPDRKCFDSRM RWK
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex