Protein

MIA_02801_1

Length
82 amino acids

Browser: contig03:1792887-1793255+

Protein function

EGGNOG:0PS2DVMA21Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum (By similarity)
SGD closest match:S000003337VMA21Vacuolar ATPase assembly integral membrane protein VMA21
CGD closest match:CAL0000184859VMA21Vacuolar ATPase assembly integral membrane protein VMA21

Protein alignments

%idAln lengthE-value
MCA_01436_163.768%696.00e-26MCA_01436_1
A0A060T0J9_BLAAD70.312%643.08e-25ARAD1C16896p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16896g PE=4 SV=1
A0A0J9XFS4_GEOCN57.576%667.50e-22Vacuolar ATPase assembly integral membrane protein VMA21 OS=Geotrichum candidum GN=VMA21 PE=3 SV=1
A0A1E3PEM7_9ASCO58.730%635.91e-22Vacuolar ATPase assembly integral membrane protein VMA21 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=VMA21 PE=3 SV=1
UniRef50_A3LU5350.820%613.64e-16Vacuolar ATPase assembly integral membrane protein VMA21 n=34 Tax=Saccharomycetales TaxID=4892 RepID=VMA21_PICST
VMA21_YEAST52.381%631.14e-16Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA21 PE=1 SV=1
A0A1D8PIG8_CANAL50.820%612.10e-16Vacuolar ATPase assembly integral membrane protein VMA21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA21 PE=3 SV=1
VMA21_YARLI49.180%614.68e-16Vacuolar ATPase assembly integral membrane protein VMA21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VMA21 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7606
Predicted cleavage: 24

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR019013
    Vacuolar ATPase assembly integral membrane protein Vma21
    1. PF09446 (VMA21)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_02801_1
MSEKRVIVPPAVVRKLAIYTAAMVIAPVASFFIVQNVFNASAIVSGGFAALVANIVLIGYVIEAYSEDFPPEEPETEEKK
EK

GO term prediction

Biological Process

GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly

Molecular Function

None predicted.

Cellular Component

None predicted.