Protein

MIA_02801_1

Length
82 amino acids


Browser: contig03:1792887-1793255+

Protein function

EGGNOG:0PS2DVMA21Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum (By similarity)
SGD closest match:S000003337VMA21Vacuolar ATPase assembly integral membrane protein VMA21
CGD closest match:CAL0000184859VMA21Vacuolar ATPase assembly integral membrane protein VMA21

Protein alignments

%idAln lengthE-value
MCA_01436_163.768%696.00e-26MCA_01436_1
A0A060T0J9_BLAAD70.312%643.08e-25ARAD1C16896p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16896g PE=4 SV=1
A0A0J9XFS4_GEOCN57.576%667.50e-22Vacuolar ATPase assembly integral membrane protein VMA21 OS=Geotrichum candidum GN=VMA21 PE=3 SV=1
A0A1E3PEM7_9ASCO58.730%635.91e-22Vacuolar ATPase assembly integral membrane protein VMA21 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=VMA21 PE=3 SV=1
UniRef50_A3LU5350.820%613.64e-16Vacuolar ATPase assembly integral membrane protein VMA21 n=34 Tax=Saccharomycetales TaxID=4892 RepID=VMA21_PICST
VMA21_YEAST52.381%631.14e-16Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA21 PE=1 SV=1
A0A1D8PIG8_CANAL50.820%612.10e-16Vacuolar ATPase assembly integral membrane protein VMA21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA21 PE=3 SV=1
VMA21_YARLI49.180%614.68e-16Vacuolar ATPase assembly integral membrane protein VMA21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VMA21 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7606
Predicted cleavage: 24

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_02801_1
MSEKRVIVPPAVVRKLAIYTAAMVIAPVASFFIVQNVFNASAIVSGGFAALVANIVLIGYVIEAYSEDFPPEEPETEEKK
EK

GO term prediction

Biological Process

GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly

Molecular Function

None predicted.

Cellular Component

None predicted.