Protein
MCA_01436_1
Length
83 amino acids
Gene name: VMA21
Description: Vacuolar ATPase assembly integral membrane protein VMA21
Browser: contigA:4447758-4448164-
RNA-seq: read pairs 465, FPKM 68.4, percentile rank 72.1% (100% = highest expression)
Protein function
Annotation: | VMA21 | Vacuolar ATPase assembly integral membrane protein VMA21 | |
---|---|---|---|
EGGNOG: | 0PS2D | VMA21 | Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum (By similarity) |
SGD closest match: | S000003337 | VMA21 | Vacuolar ATPase assembly integral membrane protein VMA21 |
CGD closest match: | CAL0000184859 | VMA21 | Vacuolar ATPase assembly integral membrane protein VMA21 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A1E3PEM7_9ASCO | 66.67% | 60 | 1e-22 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=VMA21 PE=3 SV=1 |
MIA_02801_1 | 63.08% | 65 | 4e-22 | MIA_02801_1 |
A0A0J9XFS4_GEOCN | 61.90% | 63 | 1e-20 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Geotrichum candidum GN=VMA21 PE=3 SV=1 |
A0A060T0J9_BLAAD | 63.93% | 61 | 2e-20 | ARAD1C16896p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16896g PE=4 SV=1 |
VMA21_YARLI | 61.02% | 59 | 8e-19 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VMA21 PE=3 SV=1 |
A0A1D8PIG8_CANAL | 58.06% | 62 | 2e-18 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA21 PE=3 SV=1 |
UniRef50_A3LU53 | 57.63% | 59 | 1e-14 | Vacuolar ATPase assembly integral membrane protein VMA21 n=34 Tax=Saccharomycetales TaxID=4892 RepID=VMA21_PICST |
VMA21_YEAST | 51.67% | 60 | 4e-15 | Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA21 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5574
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01436_1 MSQPRVNIPKAVVQKLMFFTFAMILGPLIAFFTVQNVFNANSIVSGGVAAFVANLVLIGYVVVAYSEDLPESSPEEKESQ KDK
GO term prediction
Biological Process
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly
Molecular Function
None predicted.
Cellular Component
None predicted.