Protein

MIA_02794_1

Length
253 amino acids

Browser: contig03:1780014-1780816+

Protein function

EGGNOG:0PH1YPGUG_01631Acetolactate synthase small subunit
SGD closest match:S000000515ILV6Acetolactate synthase small subunit, mitochondrial
CGD closest match:CAL0000184099ILV6Acetolactate synthase regulatory subunit

Protein alignments

%idAln lengthE-value
MCA_01862_179.851%1341.80e-71MCA_01862_1
UniRef50_Q6CKA045.675%2893.81e-68KLLA0F12364p n=15 Tax=Fungi TaxID=4751 RepID=Q6CKA0_KLULA
A0A0J9XGI5_GEOCN71.852%1355.96e-62Similar to Saccharomyces cerevisiae YCL009C ILV6 Regulatory subunit of acetolactate synthase OS=Geotrichum candidum GN=BN980_GECA15s00593g PE=4 SV=1
A0A161HJ41_9ASCO65.926%1356.19e-52Acetolactate synthase regulatory subunit OS=Sugiyamaella lignohabitans GN=ILV6 PE=4 SV=1
A0A060T0J3_BLAAD72.642%1063.37e-49ARAD1C16786p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16786g PE=4 SV=1
A0A1E3PF12_9ASCO62.879%1322.93e-49Acetolactate synthase small subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47742 PE=4 SV=1
Q6CCG2_YARLI57.576%1322.77e-46YALI0C09636p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09636g PE=4 SV=1
A0A1E4THW7_9ASCO56.818%1323.45e-46Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25439 PE=4 SV=1
A0A1D8PLB7_CANAL68.571%1055.21e-44Acetolactate synthase regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ILV6 PE=4 SV=1
ILV6_YEAST55.303%1321.79e-41Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8763
Predicted cleavage: 103

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 253

Detailed signature matches

  1. Family IPR004789
    Acetolactate synthase, small subunit
    1. TIGR00119
  2. Domain IPR002912
    ACT domain
    1. PF01842 (ACT)
  3. Domain IPR019455
    Acetolactate synthase, small subunit, C-terminal
    1. PF10369 (ALS_ss_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.30.70...
  3. NON_CYTOPLASM... (N...)
  4. PD002844
  5. SIGNAL_PEPTIDE (Sig...)
  6. SIGNAL_PEPTID... (S...)
  7. SIGNAL_PEPTID... (S...)
  8. SIGNAL_PEPTID... (S...)
  9. SSF55021 (ACT-like)
  10. mobidb-lite (disord...)

Protein sequence

>MIA_02794_1
MPPISSAAASRRSMATAIASLSSRQLTRANSSTSSISALAYKTLHRGSKQPPLPTIETPSWSTNAAISSILYETPNVSAP
SGTKPHVLNCLVQNEPGVLSRISGTLAARGFNIDSLVVSNTEELLHHHGQIYKRAAPSGSPASAPGRKFFHPANLAPSEA
LRHKHEHLRNITSLAHQFGGKVADISDRNCIVELCAKPDRITSFISLLQPFGILELARSGMTALPRTPLDSAGSDEGVKD
AEEIVDATQLPPG

GO term prediction

Biological Process

GO:0009082 branched-chain amino acid biosynthetic process

Molecular Function

GO:0003984 acetolactate synthase activity

Cellular Component

None predicted.