Protein

MIA_02794_1

Length
253 amino acids


Browser: contig03:1780014-1780816+

Protein function

EGGNOG:0PH1YPGUG_01631Acetolactate synthase small subunit
SGD closest match:S000000515ILV6Acetolactate synthase small subunit, mitochondrial
CGD closest match:CAL0000184099ILV6Acetolactate synthase regulatory subunit

Protein alignments

%idAln lengthE-value
MCA_01862_179.851%1341.80e-71MCA_01862_1
UniRef50_Q6CKA045.675%2893.81e-68KLLA0F12364p n=15 Tax=Fungi TaxID=4751 RepID=Q6CKA0_KLULA
A0A0J9XGI5_GEOCN71.852%1355.96e-62Similar to Saccharomyces cerevisiae YCL009C ILV6 Regulatory subunit of acetolactate synthase OS=Geotrichum candidum GN=BN980_GECA15s00593g PE=4 SV=1
A0A161HJ41_9ASCO65.926%1356.19e-52Acetolactate synthase regulatory subunit OS=Sugiyamaella lignohabitans GN=ILV6 PE=4 SV=1
A0A060T0J3_BLAAD72.642%1063.37e-49ARAD1C16786p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16786g PE=4 SV=1
A0A1E3PF12_9ASCO62.879%1322.93e-49Acetolactate synthase small subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47742 PE=4 SV=1
Q6CCG2_YARLI57.576%1322.77e-46YALI0C09636p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09636g PE=4 SV=1
A0A1E4THW7_9ASCO56.818%1323.45e-46Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25439 PE=4 SV=1
A0A1D8PLB7_CANAL68.571%1055.21e-44Acetolactate synthase regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ILV6 PE=4 SV=1
ILV6_YEAST55.303%1321.79e-41Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8763
Predicted cleavage: 103

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 253

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55021 (ACT-like)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_02794_1
MPPISSAAASRRSMATAIASLSSRQLTRANSSTSSISALAYKTLHRGSKQPPLPTIETPSWSTNAAISSILYETPNVSAP
SGTKPHVLNCLVQNEPGVLSRISGTLAARGFNIDSLVVSNTEELLHHHGQIYKRAAPSGSPASAPGRKFFHPANLAPSEA
LRHKHEHLRNITSLAHQFGGKVADISDRNCIVELCAKPDRITSFISLLQPFGILELARSGMTALPRTPLDSAGSDEGVKD
AEEIVDATQLPPG

GO term prediction

Biological Process

GO:0009082 branched-chain amino acid biosynthetic process

Molecular Function

GO:0003984 acetolactate synthase activity

Cellular Component

None predicted.