Protein

MCA_01862_1

Length
313 amino acids

Gene name: ILV6

Description: Acetolactate synthase small subunit, mitochondrial

Browser: contigA:5715799-5716741+

RNA-seq: read pairs 6491, FPKM 255.4, percentile rank 90.6% (100% = highest expression)

Protein function

Annotation:ILV6Acetolactate synthase small subunit, mitochondrial
KEGG:K01653E2.2.1.6S acetolactate synthase I/III small subunit [EC:2.2.1.6]
EGGNOG:0PH1YPGUG_01631Acetolactate synthase small subunit
SGD closest match:S000000515ILV6Acetolactate synthase small subunit, mitochondrial
CGD closest match:CAL0000184099ILV6Acetolactate synthase regulatory subunit

Protein alignments

%idAln lengthE-value
A0A0J9XGI5_GEOCN75.17%2941e-165Similar to Saccharomyces cerevisiae YCL009C ILV6 Regulatory subunit of acetolactate synthase OS=Geotrichum candidum GN=BN980_GECA15s00593g PE=4 SV=1
A0A161HJ41_9ASCO71.72%2909e-151Acetolactate synthase regulatory subunit OS=Sugiyamaella lignohabitans GN=ILV6 PE=4 SV=1
A0A1E3PF12_9ASCO69.90%2994e-151Acetolactate synthase small subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47742 PE=4 SV=1
A0A060T0J3_BLAAD71.29%3031e-149ARAD1C16786p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16786g PE=4 SV=1
A0A1E4THW7_9ASCO66.78%2922e-143Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25439 PE=4 SV=1
A0A1D8PLB7_CANAL67.56%2994e-139Acetolactate synthase regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ILV6 PE=4 SV=1
Q6CCG2_YARLI67.02%2821e-136YALI0C09636p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09636g PE=4 SV=1
UniRef50_Q6CKA062.76%2905e-129KLLA0F12364p n=15 Tax=Fungi TaxID=4751 RepID=Q6CKA0_KLULA
ILV6_YEAST62.38%3035e-132Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2
MIA_02794_180.00%1356e-72MIA_02794_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9800
Predicted cleavage: 34

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 313

Detailed signature matches

  1. Family IPR004789
    Acetolactate synthase, small subunit
    1. TIGR00119
  2. Domain IPR002912
    ACT domain
    1. PF01842 (ACT)
    2. PS51671 (ACT)
  3. Domain IPR019455
    Acetolactate synthase, small subunit, C-terminal
    1. PF10369 (ALS_ss_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.30.70...
  3. PD002844
  4. SSF55021 (ACT-like)
  5. cd04878 (ACT_AHAS)
  6. mobidb-lite (disord...)

Residue annotation

  1. putative valine bi...
  2. dimer interface cd...

Protein sequence

>MCA_01862_1
MVLCPSVAPRGCFTARTALKTSSRIFTRNNSSSISALAYKTLHRQNKQPSLPTIETPNWSTNAAISSILYETPIVTEQKA
KPHVLNCLVQNEPGVLSRISGTLAARGFNIDSLVVSNTEVSDLSRMTIVLQGLDGVVEQARRQIEDLVPVWAVLDYTNAP
LVQRELLLARVSLLGPEYFQELLEHHGQIYKKSTNNSPTTTQSKSNHKNFHPSNLAPSEALRHKHEHLRNITALANQFGG
KVADISDRNCIVELCAKPNRITSFISLLQPFGILELARSGMTALPRTPLDSSLSSDGAKDAEEIVDATQLPPG

GO term prediction

Biological Process

GO:0009082 branched-chain amino acid biosynthetic process

Molecular Function

GO:0003984 acetolactate synthase activity

Cellular Component

None predicted.