Protein

MIA_02753_1

Length
249 amino acids

Browser: contig03:1653432-1654182-

Protein function

EGGNOG:0PN7DPGUG_03328glutaredoxin domain protein
SGD closest match:S000000218GRX7Monothiol glutaredoxin-7
CGD closest match:CAL0000192543orf19.4150Glutathione-disulfide reductase

Protein alignments

%idAln lengthE-value
A0A0J9XCN2_GEOCN67.021%944.17e-43Similar to Saccharomyces cerevisiae YDL010W GRX6 Cis-golgi localized monothiol glutaredoxin that binds an iron-sulfur cluster OS=Geotrichum candidum GN=BN980_GECA10s02133g PE=4 SV=1
MCA_05565_152.542%1188.66e-39MCA_05565_1
A0A060T0G4_BLAAD61.702%942.60e-38ARAD1C07502p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C07502g PE=4 SV=1
UniRef50_A0A060T0G461.702%946.42e-35ARAD1C07502p n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A060T0G4_BLAAD
A0A1E3PPG4_9ASCO58.654%1047.93e-38Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46118 PE=4 SV=1
Q6C034_YARLI53.061%988.97e-30YALI0F28127p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F28127g PE=4 SV=1
Q59NQ2_CANAL53.261%921.19e-28Glutathione-disulfide reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4150 PE=4 SV=1
A0A1E4TCR7_9ASCO50.549%913.12e-29Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13921 PE=4 SV=1
GLRX7_YEAST40.336%1196.91e-25Monothiol glutaredoxin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX7 PE=1 SV=1
A0A167DUM9_9ASCO33.333%901.83e-10Dithiol glutaredoxin GRX2 OS=Sugiyamaella lignohabitans GN=GRX2 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3844
Predicted cleavage: 31

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 249

Detailed signature matches

  1. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  2. Domain IPR002109
    Glutaredoxin
    1. PF00462 (Glutaredoxin)
    2. PS51354 (GLUTAREDOX...)
  3. Domain IPR014025
    Glutaredoxin subgroup
    1. PR00160 (GLUTAREDOXIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10
  2. NON_CYTOPLASM... (N...)
  3. SFLDG00328 (Glutare...)
  4. SIGNAL_PEPTIDE (Sig...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. SIGNAL_PEPTID... (S...)
  8. TMhelix
  9. cd03419 (GRX_GRXh_1...)
  10. mobidb-lite (disord...)

Residue annotation

  1. GSH binding site c...
  2. SFLDG00328
  3. catalytic residues...

Protein sequence

>MIA_02753_1
MVSSRRSRILTIAAIISTIFFFLFSTASRGPPQSAGPGPSPHKPADKVSPEIAGAFKAAQDNVRLQPVTESKVPGAGLVD
EQDATAPAGGAVEKVSEAVAAAPTESQEDQPASSAAADPPAYDAAAEYAKTIRDAPLVIFSKSYCPHSKFAKQLLLHEYS
ITPKPIVVELDQHPNGSELQQHIGQVTGRRTVPNVHVLGTSRGGADDFRALKAEGNVVEQLLEWAKHGLYEHRGPGPAFT
IEANEPSQE

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis

Molecular Function

GO:0009055 electron carrier activity
GO:0015035 protein disulfide oxidoreductase activity

Cellular Component

None predicted.