Protein
MIA_02689_1
Length
149 amino acids
Browser: contig03:1460653-1461351-
Protein function
| EGGNOG: | 0PNX9 | NUT2 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors |
|---|---|---|---|
| SGD closest match: | S000006372 | NUT2 | Mediator of RNA polymerase II transcription subunit 10 |
| CGD closest match: | CAL0000183331 | NUT2 | Mediator of RNA polymerase II transcription subunit 10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XGR2_GEOCN | 63.433% | 134 | 5.03e-60 | Similar to Saccharomyces cerevisiae YPR168W NUT2 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA15s01803g PE=4 SV=1 |
| A0A1E3PTF7_9ASCO | 61.940% | 134 | 6.32e-58 | Subunit of the RNA polymerase II mediator complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81485 PE=4 SV=1 |
| UniRef50_A0A1E3PTF7 | 61.940% | 134 | 1.71e-54 | Subunit of the RNA polymerase II mediator complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PTF7_9ASCO |
| MCA_03035_1 | 59.124% | 137 | 1.44e-54 | MCA_03035_1 |
| A0A060T9T1_BLAAD | 59.167% | 120 | 1.10e-49 | ARAD1B01936p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B01936g PE=4 SV=1 |
| MED10_CANAL | 38.158% | 152 | 1.11e-36 | Mediator of RNA polymerase II transcription subunit 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUT2 PE=3 SV=1 |
| MED10_YEAST | 40.441% | 136 | 2.60e-33 | Mediator of RNA polymerase II transcription subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUT2 PE=1 SV=1 |
| MED10_YARLI | 54.545% | 99 | 1.11e-30 | Mediator of RNA polymerase II transcription subunit 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NUT2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0181
Protein family membership
- Mediator complex, subunit Med10 (IPR019145)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_02689_1 MPSPSVLPTPPTDLLETEDQLRRVIQTLIEMGIMVHDFQGTEESKEGLTDRVSVMTRQLDELAVESNRLKEEFPIDVVQY IENGRNPDVYTREFVELAAKQNQYINGKMKAMVQFRDILGDAIKTAYPNLENAIDNVKRRTTPQNSENK
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex