Protein
MCA_03035_1
Length
227 amino acids
Gene name: NUT2
Description: Mediator of RNA polymerase II transcription subunit 10
Browser: contigB:3159002-3159686+
RNA-seq: read pairs 678, FPKM 36.7, percentile rank 58.4% (100% = highest expression)
Protein function
| Annotation: | NUT2 | Mediator of RNA polymerase II transcription subunit 10 | |
|---|---|---|---|
| KEGG: | K15151 | MED10 | mediator of RNA polymerase II transcription subunit 10 |
| EGGNOG: | 0PNX9 | NUT2 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors |
| SGD closest match: | S000006372 | NUT2 | Mediator of RNA polymerase II transcription subunit 10 |
| CGD closest match: | CAL0000183331 | NUT2 | Mediator of RNA polymerase II transcription subunit 10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02689_1 | 59.12% | 137 | 9e-53 | MIA_02689_1 |
| A0A0J9XGR2_GEOCN | 52.55% | 137 | 4e-45 | Similar to Saccharomyces cerevisiae YPR168W NUT2 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA15s01803g PE=4 SV=1 |
| A0A060T9T1_BLAAD | 55.12% | 127 | 1e-42 | ARAD1B01936p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B01936g PE=4 SV=1 |
| A0A1E3PTF7_9ASCO | 51.82% | 137 | 3e-40 | Subunit of the RNA polymerase II mediator complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81485 PE=4 SV=1 |
| UniRef50_A0A1E3PTF7 | 51.82% | 137 | 7e-37 | Subunit of the RNA polymerase II mediator complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PTF7_9ASCO |
| MED10_CANAL | 38.57% | 140 | 4e-29 | Mediator of RNA polymerase II transcription subunit 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUT2 PE=3 SV=1 |
| MED10_YEAST | 38.89% | 144 | 1e-28 | Mediator of RNA polymerase II transcription subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUT2 PE=1 SV=1 |
| MED10_YARLI | 41.12% | 107 | 8e-22 | Mediator of RNA polymerase II transcription subunit 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NUT2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1555
Protein family membership
- Mediator complex, subunit Med10 (IPR019145)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_03035_1 MTSFSEFSNRPQDNGTMDSNNWQNGTNGNSEAPREQSLQTSESTSSNDHFLQQLANTQQKIKEIIDNIIQTSVIVYDFQG TDMSKEALVEQFNLLTRQLDELAVQSSAKPTNSSNTRDDDFFPLDVIQYIENGRNPDVYTREFVELAAKQNQYINGKMTA MFQFQNILGDAIKETYPELVSAVDNVKERTKFTGDLSKLGVKVEDNENDRYNNGSIPNGNKTTQNGK
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex