Protein

MCA_03035_1

Length
227 amino acids


Gene name: NUT2

Description: Mediator of RNA polymerase II transcription subunit 10

Browser: contigB:3159002-3159686+

RNA-seq: read pairs 678, FPKM 36.7, percentile rank 58.4% (100% = highest expression)

Protein function

Annotation:NUT2Mediator of RNA polymerase II transcription subunit 10
KEGG:K15151MED10 mediator of RNA polymerase II transcription subunit 10
EGGNOG:0PNX9NUT2Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
SGD closest match:S000006372NUT2Mediator of RNA polymerase II transcription subunit 10
CGD closest match:CAL0000183331NUT2Mediator of RNA polymerase II transcription subunit 10

Protein alignments

%idAln lengthE-value
MIA_02689_159.12%1379e-53MIA_02689_1
A0A0J9XGR2_GEOCN52.55%1374e-45Similar to Saccharomyces cerevisiae YPR168W NUT2 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA15s01803g PE=4 SV=1
A0A060T9T1_BLAAD55.12%1271e-42ARAD1B01936p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B01936g PE=4 SV=1
A0A1E3PTF7_9ASCO51.82%1373e-40Subunit of the RNA polymerase II mediator complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81485 PE=4 SV=1
UniRef50_A0A1E3PTF751.82%1377e-37Subunit of the RNA polymerase II mediator complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PTF7_9ASCO
MED10_CANAL38.57%1404e-29Mediator of RNA polymerase II transcription subunit 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUT2 PE=3 SV=1
MED10_YEAST38.89%1441e-28Mediator of RNA polymerase II transcription subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUT2 PE=1 SV=1
MED10_YARLI41.12%1078e-22Mediator of RNA polymerase II transcription subunit 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NUT2 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1555

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_03035_1
MTSFSEFSNRPQDNGTMDSNNWQNGTNGNSEAPREQSLQTSESTSSNDHFLQQLANTQQKIKEIIDNIIQTSVIVYDFQG
TDMSKEALVEQFNLLTRQLDELAVQSSAKPTNSSNTRDDDFFPLDVIQYIENGRNPDVYTREFVELAAKQNQYINGKMTA
MFQFQNILGDAIKETYPELVSAVDNVKERTKFTGDLSKLGVKVEDNENDRYNNGSIPNGNKTTQNGK

GO term prediction

Biological Process

GO:0006357 regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex