Protein

MIA_02669_1

Length
191 amino acids

Browser: contig03:1410713-1412479+

Protein function

EGGNOG:0PH0NCDC42cell division control protein 42
SGD closest match:S000004219CDC42Cell division control protein 42
CGD closest match:CAL0000192612CDC42Cell division control protein 42 homolog

Protein alignments

%idAln lengthE-value
A0A0J9YHC9_GEOCN93.19%1912e-134Similar to Saccharomyces cerevisiae YLR229C CDC42 Small rho-like GTPase OS=Geotrichum candidum GN=BN980_GECA01s02441g PE=3 SV=1
UniRef50_A0A1R1Y3S386.39%1914e-123Cell division control protein 42 n=2 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1Y3S3_9FUNG
MCA_04110_189.06%1926e-128MCA_04110_1
A0A060T8U5_BLAAD87.96%1917e-128ARAD1C32340p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32340g PE=3 SV=1
Q6CEG8_YARLI87.43%1913e-127YALI0B15752p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15752g PE=3 SV=2
A0A167DWR6_9ASCO87.96%1917e-126Rho family GTPase CDC42 OS=Sugiyamaella lignohabitans GN=CDC42 PE=3 SV=1
CDC42_YEAST85.86%1916e-125Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2
CDC42_CANAL84.82%1911e-121Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1
A0A1E4T9B0_9ASCO83.16%1909e-120Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_145706 PE=3 SV=1
A0A1E3PQT7_9ASCO83.67%1471e-92Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44537 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0377

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 191

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR003578
    Small GTPase superfamily, Rho type
    1. PS51420 (RHO)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.40.50...
  3. PR00449 (RASTRNSFRMNG)
  4. SM00173 (ras_sub_4)
  5. SM00174 (rho_sub_3)
  6. SM00175 (rab_sub_5)
  7. cd01874 (Cdc42)

Residue annotation

  1. GEF (guanine nucle...
  2. ACK tyrosine kinas...
  3. G1 box cd01874
  4. GTP/Mg2+ binding s...
  5. CRIB effector inte...
  6. Par6 cell polarity...
  7. Switch I region cd...
  8. GAP (GTPase-activa...
  9. G2 box cd01874
  10. GDI (guanine nucle...
  11. G3 box cd01874
  12. Switch II region c...
  13. G4 box cd01874
  14. G5 box cd01874

Protein sequence

>MIA_02669_1
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV
CFSVTSPSSFENVKEKWLPEVRHHCPGVPCLIVGTQIDLRNDSNVVDKLSRQRLRPITTENGEKLAKEMGAVKYVECSAL
TQRGLKNVFDEAIVAALEPPVIKKSKRCILL

GO term prediction

Biological Process

GO:0007264 small GTPase mediated signal transduction

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular