Protein

MCA_04110_1

Length
192 amino acids

Gene name: CDC42

Description: Cell division control protein 42

Browser: contigC:2045500-2046770+

RNA-seq: read pairs 2076, FPKM 132.9, percentile rank 83.3% (100% = highest expression)

Protein function

Annotation:CDC42Cell division control protein 42
KEGG:K04393CDC42 cell division control protein 42
EGGNOG:0PH0NCDC42cell division control protein 42
SGD closest match:S000004219CDC42Cell division control protein 42
CGD closest match:CAL0000192612CDC42Cell division control protein 42 homolog

Protein alignments

%idAln lengthE-value
A0A0J9YHC9_GEOCN93.23%1923e-132Similar to Saccharomyces cerevisiae YLR229C CDC42 Small rho-like GTPase OS=Geotrichum candidum GN=BN980_GECA01s02441g PE=3 SV=1
MIA_02669_189.06%1926e-128MIA_02669_1
UniRef50_Q0111286.98%1927e-123Cell division control protein 42 homolog n=52 Tax=Opisthokonta TaxID=33154 RepID=CDC42_SCHPO
A0A167DWR6_9ASCO88.54%1924e-126Rho family GTPase CDC42 OS=Sugiyamaella lignohabitans GN=CDC42 PE=3 SV=1
A0A060T8U5_BLAAD88.02%1924e-126ARAD1C32340p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32340g PE=3 SV=1
Q6CEG8_YARLI86.46%1925e-123YALI0B15752p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15752g PE=3 SV=2
CDC42_YEAST83.85%1925e-121Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2
A0A1E4T9B0_9ASCO82.20%1915e-119Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_145706 PE=3 SV=1
CDC42_CANAL81.25%1928e-116Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1
A0A1E3PDI1_9ASCO63.45%1973e-91Structural basis of promiscuous guanine nucleotide exchange By the T-cell essential Vav1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84150 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0368

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 192

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR003578
    Small GTPase superfamily, Rho type
    1. PS51420 (RHO)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.40.50...
  3. PR00449 (RASTRNSFRMNG)
  4. SM00173 (ras_sub_4)
  5. SM00174 (rho_sub_3)
  6. SM00175 (rab_sub_5)
  7. SM00176 (ran_sub_2)
  8. cd01874 (Cdc42)

Residue annotation

  1. GEF (guanine nucle...
  2. ACK tyrosine kinas...
  3. G1 box cd01874
  4. GTP/Mg2+ binding s...
  5. CRIB effector inte...
  6. Par6 cell polarity...
  7. Switch I region cd...
  8. GAP (GTPase-activa...
  9. G2 box cd01874
  10. GDI (guanine nucle...
  11. G3 box cd01874
  12. Switch II region c...
  13. G4 box cd01874
  14. G5 box cd01874

Protein sequence

>MCA_04110_1
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV
CFSVTSPSSFENVKEKWLPEVHHHCPGVPCLIVGTQVDLREDPATVEKLARQRLRPVSTENGERLAKELGAVRYVECSAL
TQKGLKNVFDEAIVAALEPPVPATKKRKCIIL

GO term prediction

Biological Process

GO:0007264 small GTPase mediated signal transduction

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular