Protein

MIA_02660_1

Length
388 amino acids


Browser: contig03:1376902-1378252+

Protein function

EGGNOG:0PMN5EAF3Involved in deacetylation of histones, chromatin assembly and chromosome segregation. May act as a transcriptional oscillator, directing histone deacetylases to specific chromosomal domains. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair (By similarity)
SGD closest match:S000006227EAF3Chromatin modification-related protein EAF3
CGD closest match:CAL0000193590EAF3Chromatin modification-related protein EAF3

Protein alignments

%idAln lengthE-value
MCA_05508_159.155%4268.31e-173MCA_05508_1
A0A0J9XES4_GEOCN53.494%4155.95e-151Similar to Saccharomyces cerevisiae YPR023C EAF3 Esa1p-associated factor OS=Geotrichum candidum GN=BN980_GECA11s00615g PE=4 SV=1
UniRef50_A0A0J9XES453.494%4151.22e-147Similar to Saccharomyces cerevisiae YPR023C EAF3 Esa1p-associated factor n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XES4_GEOCN
A0A1E3PNT4_9ASCO50.663%3771.52e-124MRG-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45215 PE=4 SV=1
A0A060T7N6_BLAAD45.361%3883.70e-118ARAD1D00968p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00968g PE=4 SV=1
A0A167CQA4_9ASCO47.230%3793.75e-113Eaf3p OS=Sugiyamaella lignohabitans GN=EAF3 PE=4 SV=1
EAF3_YARLI39.019%4285.17e-92Chromatin modification-related protein EAF3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF3 PE=3 SV=1
A0A1E4TJJ3_9ASCO50.000%2204.73e-70Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18276 PE=4 SV=1
EAF3_YEAST34.913%4011.71e-62Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF3 PE=1 SV=1
EAF3_CANAL28.244%3931.81e-50Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAF3 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0135

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 388

Detailed signature matches

    1. SSF54160 (Chromo do...)
    1. PF11717 (Tudor-knot)
    1. PF05712 (MRG)
    2. PS51640 (MRG)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd00024 (CHROMO)
  2. mobidb-lite (disord...)

Residue annotation

  1. histone binding si...

Protein sequence

>MIA_02660_1
MAPPSFPHKCLAFHGPMLYEAKTIKIWDPEEQTVRTKSSETSGEPYATKGEIPSDLPPELETKVAYYIHYKGWKSTWDEW
VSDDRVLAWNEENLRTQKELKTIALAAANKRRQGAGSVAISVVSGSHNGGSALNGSSSADTAANGDSTHDNSANGRHADG
DDDPNGTAHASPNVDHVAGTKRRDYSHKDEVAHSGRSTKRGRNLDLDLEKEEDYIRKPEVSLTVPDPLKSVLVDDWEFIT
KEHQVVPLPREITVADMLDMYRKSVGKKKPGTAEYDIFEEVLAGVKLYFDRALGNILLYRFERQQYLSIKQKYPDKPASE
IYGPEHLLRLFVSFPALIAQTNMDQQSIGILREHLQDLLRFMVDHKKKLFLKDYKNTSPQYEAISRSF

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.