Protein

MIA_02641_1

Length
57 amino acids


Browser: contig03:1325092-1325318-

Protein function

EGGNOG:0PRTIPMP3Plasma membrane proteolipid 3
SGD closest match:S000002684PMP3Plasma membrane proteolipid 3
CGD closest match:CAL0000199083orf19.2959.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9X7P4_GEOCN92.982%571.53e-34Similar to Saccharomyces cerevisiae YDR276C PMP3 Small plasma membrane protein related to a family of plant polypeptides that are overexpressed under high salt concentration or low temperature OS=Geotrichum candidum GN=BN980_GECA04s06665g PE=4 SV=1
MCA_03000_178.947%572.88e-29MCA_03000_1
A0A1E3PEE0_9ASCO78.947%574.49e-28Cation transport-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53237 PE=4 SV=1
Q6C8V6_YARLI75.439%571.00e-27YALI0D16665p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D16665g PE=4 SV=2
UniRef50_Q9C1W473.684%573.77e-24Plasma membrane proteolipid 3 n=307 Tax=root TaxID=1 RepID=PMP3_SCHPO
A0A1E4TIC3_9ASCO64.151%538.47e-20Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29901 PE=4 SV=1
A0A1D8PCT3_CANAL70.175%571.79e-19Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2959.1 PE=4 SV=1
PMP3_YEAST44.231%521.83e-13Plasma membrane proteolipid 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMP3 PE=1 SV=1
A0A060T605_BLAAD46.154%528.21e-11ARAD1C09966p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09966g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0013

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PS01309 (UPF0057)
    2. PF01679 (Pmp3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_02641_1
MAFTGSDIFKIILAVIFPPLGVFLERGCNMDLLINVVLTCLGWFPGIIHALYIIFKY

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0016021 integral component of membrane