Protein
MCA_03000_1
Length
57 amino acids
Gene name: PMP3
Description: Plasma membrane proteolipid 3
Browser: contigB:3039760-3040046+
RNA-seq: read pairs 15374, FPKM 3275.2, percentile rank 98.7% (100% = highest expression)
Protein function
| Annotation: | PMP3 | Plasma membrane proteolipid 3 | |
|---|---|---|---|
| EGGNOG: | 0PRTI | PMP3 | Plasma membrane proteolipid 3 |
| SGD closest match: | S000002684 | PMP3 | Plasma membrane proteolipid 3 |
| CGD closest match: | CAL0000199083 | orf19.2959.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X7P4_GEOCN | 82.46% | 57 | 3e-28 | Similar to Saccharomyces cerevisiae YDR276C PMP3 Small plasma membrane protein related to a family of plant polypeptides that are overexpressed under high salt concentration or low temperature OS=Geotrichum candidum GN=BN980_GECA04s06665g PE=4 SV=1 |
| MIA_02641_1 | 78.95% | 57 | 4e-28 | MIA_02641_1 |
| Q6C8V6_YARLI | 73.68% | 57 | 7e-25 | YALI0D16665p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D16665g PE=4 SV=2 |
| UniRef50_Q9C1W4 | 70.18% | 57 | 4e-21 | Plasma membrane proteolipid 3 n=307 Tax=root TaxID=1 RepID=PMP3_SCHPO |
| A0A1E3PEE0_9ASCO | 76.79% | 56 | 8e-24 | Cation transport-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53237 PE=4 SV=1 |
| A0A1D8PCT3_CANAL | 77.19% | 57 | 9e-20 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2959.1 PE=4 SV=1 |
| A0A1E4TIC3_9ASCO | 62.26% | 53 | 1e-17 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29901 PE=4 SV=1 |
| A0A060T605_BLAAD | 40.38% | 52 | 6e-09 | ARAD1C09966p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09966g PE=4 SV=1 |
| PMP3_YEAST | 33.96% | 53 | 6e-09 | Plasma membrane proteolipid 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMP3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0006
Protein family membership
- Proteolipid membrane potential modulator (IPR000612)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_03000_1 MPFTGSDIFKILLAIILPPLGVFLETGCDMNLLINVLLTCLGYIPGIIHALYVIFKH
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane