Protein
MIA_02585_1
Length
154 amino acids
Browser: contig03:1197657-1198122+
Protein function
| EGGNOG: | 0PPQD | PGUG_00924 | Functions as component of the Arp2 3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity) |
|---|---|---|---|
| SGD closest match: | S000001324 | ARC15 | Actin-related protein 2/3 complex subunit 5 |
| CGD closest match: | CAL0000189792 | ARC15 | Actin-related protein 2/3 complex subunit 5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_03071_1 | 71.429% | 154 | 1.51e-83 | MCA_03071_1 |
| A0A0J9XKV8_GEOCN | 64.238% | 151 | 5.99e-69 | Actin-related protein 2/3 complex subunit 5 OS=Geotrichum candidum GN=BN980_GECA32s02617g PE=3 SV=1 |
| A0A060TF04_BLAAD | 63.158% | 152 | 8.86e-60 | Actin-related protein 2/3 complex subunit 5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D12056g PE=3 SV=1 |
| Q6C6B4_YARLI | 55.484% | 155 | 3.93e-58 | Actin-related protein 2/3 complex subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10857g PE=3 SV=1 |
| UniRef50_Q6C6B4 | 55.484% | 155 | 9.12e-55 | Actin-related protein 2/3 complex subunit 5 n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6C6B4_YARLI |
| A0A1E3PRJ0_9ASCO | 54.194% | 155 | 5.40e-55 | Actin-related protein 2/3 complex subunit 5 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48703 PE=3 SV=1 |
| Q59RN2_CANAL | 40.625% | 160 | 8.22e-38 | Actin-related protein 2/3 complex subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC15 PE=3 SV=1 |
| ARPC5_YEAST | 37.419% | 155 | 3.27e-31 | Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 |
| A0A1E4TC58_9ASCO | 29.412% | 170 | 1.82e-15 | Actin-related protein 2/3 complex subunit 5 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3928 PE=3 SV=1 |
| A0A161HGK2_9ASCO | 44.444% | 72 | 6.82e-14 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_2514 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0482
Protein family membership
- Actin-related protein 2/3 complex subunit 5 (IPR006789)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
SSF69103 (Arp2/3 co...)
-
PIRSF039096 (p16-ARC)
-
PF04699 (P16-Arc)
-
Protein sequence
>MIA_02585_1 MAEIDFRRIDVDQYDPDRFLVESLIPPEPPVSLDEIKQRSVAVKRLLSQGDYQGALETALRNPPYGGSPEVKNVNLQTVL DVLLTLKSNTITPIIEALTPELQDVLIKYIYKGMGSPLGQTHGNGVALLLWFEKTVDITSQGAIIRYMSDRRTV
GO term prediction
Biological Process
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation
Molecular Function
None predicted.
Cellular Component
GO:0005885 Arp2/3 protein complex
GO:0015629 actin cytoskeleton