Protein

MIA_02585_1

Length
154 amino acids


Browser: contig03:1197657-1198122+

Protein function

EGGNOG:0PPQDPGUG_00924Functions as component of the Arp2 3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity)
SGD closest match:S000001324ARC15Actin-related protein 2/3 complex subunit 5
CGD closest match:CAL0000189792ARC15Actin-related protein 2/3 complex subunit 5

Protein alignments

%idAln lengthE-value
MCA_03071_171.429%1541.51e-83MCA_03071_1
A0A0J9XKV8_GEOCN64.238%1515.99e-69Actin-related protein 2/3 complex subunit 5 OS=Geotrichum candidum GN=BN980_GECA32s02617g PE=3 SV=1
A0A060TF04_BLAAD63.158%1528.86e-60Actin-related protein 2/3 complex subunit 5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D12056g PE=3 SV=1
Q6C6B4_YARLI55.484%1553.93e-58Actin-related protein 2/3 complex subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10857g PE=3 SV=1
UniRef50_Q6C6B455.484%1559.12e-55Actin-related protein 2/3 complex subunit 5 n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6C6B4_YARLI
A0A1E3PRJ0_9ASCO54.194%1555.40e-55Actin-related protein 2/3 complex subunit 5 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48703 PE=3 SV=1
Q59RN2_CANAL40.625%1608.22e-38Actin-related protein 2/3 complex subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC15 PE=3 SV=1
ARPC5_YEAST37.419%1553.27e-31Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1
A0A1E4TC58_9ASCO29.412%1701.82e-15Actin-related protein 2/3 complex subunit 5 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3928 PE=3 SV=1
A0A161HGK2_9ASCO44.444%726.82e-14Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_2514 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0482

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF69103 (Arp2/3 co...)
    2. PIRSF039096 (p16-ARC)
    3. PF04699 (P16-Arc)

Protein sequence

>MIA_02585_1
MAEIDFRRIDVDQYDPDRFLVESLIPPEPPVSLDEIKQRSVAVKRLLSQGDYQGALETALRNPPYGGSPEVKNVNLQTVL
DVLLTLKSNTITPIIEALTPELQDVLIKYIYKGMGSPLGQTHGNGVALLLWFEKTVDITSQGAIIRYMSDRRTV

GO term prediction

Biological Process

GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation

Molecular Function

None predicted.

Cellular Component

GO:0005885 Arp2/3 protein complex
GO:0015629 actin cytoskeleton