Protein
MCA_03071_1
Length
154 amino acids
Browser: contigB:3274330-3274866+
RNA-seq: read pairs 4150, FPKM 330.8, percentile rank 92.5% (100% = highest expression)
Protein function
| KEGG: | K05754 | ARPC5 | actin related protein 2/3 complex, subunit 5 |
|---|---|---|---|
| EGGNOG: | 0PPQD | PGUG_00924 | Functions as component of the Arp2 3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity) |
| SGD closest match: | S000001324 | ARC15 | Actin-related protein 2/3 complex subunit 5 |
| CGD closest match: | CAL0000189792 | ARC15 | Actin-related protein 2/3 complex subunit 5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02585_1 | 71.43% | 154 | 6e-82 | MIA_02585_1 |
| A0A0J9XKV8_GEOCN | 66.23% | 151 | 2e-70 | Actin-related protein 2/3 complex subunit 5 OS=Geotrichum candidum GN=BN980_GECA32s02617g PE=3 SV=1 |
| A0A1E3PRJ0_9ASCO | 58.71% | 155 | 2e-62 | Actin-related protein 2/3 complex subunit 5 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48703 PE=3 SV=1 |
| A0A060TF04_BLAAD | 57.24% | 152 | 1e-57 | Actin-related protein 2/3 complex subunit 5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D12056g PE=3 SV=1 |
| Q6C6B4_YARLI | 53.55% | 155 | 7e-57 | Actin-related protein 2/3 complex subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10857g PE=3 SV=1 |
| UniRef50_Q6C6B4 | 53.55% | 155 | 2e-53 | Actin-related protein 2/3 complex subunit 5 n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6C6B4_YARLI |
| Q59RN2_CANAL | 45.62% | 160 | 5e-41 | Actin-related protein 2/3 complex subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC15 PE=3 SV=1 |
| ARPC5_YEAST | 41.29% | 155 | 1e-35 | Actin-related protein 2/3 complex subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC15 PE=1 SV=1 |
| A0A1E4TC58_9ASCO | 32.80% | 125 | 3e-17 | Actin-related protein 2/3 complex subunit 5 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3928 PE=3 SV=1 |
| A0A161HGK2_9ASCO | 45.83% | 72 | 2e-14 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_2514 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0279
Protein family membership
- Actin-related protein 2/3 complex subunit 5 (IPR006789)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
SSF69103 (Arp2/3 co...)
-
PIRSF039096 (p16-ARC)
-
PF04699 (P16-Arc)
-
Protein sequence
>MCA_03071_1 MAEVNFRKIDIDQYDPDRFLASDLIPPQPPVTAEEMRQKQQVVKRALSSGDYQGALVSALSDPPYGGDEEAKNINLQTVL DVLTAIRSNSITSAVESLSSELRDVLIKYIYKGMGSTLGQTHGNGGVLLTWFEKTVDITSQGAIVRYMSDRRTV
GO term prediction
Biological Process
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation
Molecular Function
None predicted.
Cellular Component
GO:0005885 Arp2/3 protein complex
GO:0015629 actin cytoskeleton