Protein
MIA_02547_1
Length
140 amino acids
Browser: contig03:1094950-1095419-
Protein function
| EGGNOG: | 0PQ4G | COX6 | cytochrome C oxidase |
|---|---|---|---|
| SGD closest match: | S000001093 | COX6 | Cytochrome c oxidase subunit 6, mitochondrial |
| CGD closest match: | CAL0000187468 | COX6 | Cytochrome c oxidase subunit VI |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02980_1 | 79.091% | 110 | 2.26e-55 | MCA_02980_1 |
| A0A0J9X695_GEOCN | 82.727% | 110 | 3.94e-53 | Similar to Saccharomyces cerevisiae YHR051W COX6 Subunit VI of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA03s05015g PE=4 SV=1 |
| A0A060T2A3_BLAAD | 78.182% | 110 | 1.06e-46 | ARAD1A00440p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00440g PE=4 SV=1 |
| A0A1D8PH08_CANAL | 72.566% | 113 | 2.93e-46 | Cytochrome c oxidase subunit VI OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX6 PE=4 SV=1 |
| UniRef50_A0A1D8PH08 | 72.566% | 113 | 7.12e-43 | Cytochrome c oxidase subunit VI n=108 Tax=Opisthokonta TaxID=33154 RepID=A0A1D8PH08_CANAL |
| Q6C6E6_YARLI | 73.148% | 108 | 8.88e-45 | YALI0E10144p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10144g PE=4 SV=1 |
| A0A1E3PER3_9ASCO | 67.290% | 107 | 9.06e-45 | COX5A-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48240 PE=4 SV=1 |
| A0A1E4TB32_9ASCO | 75.701% | 107 | 6.24e-44 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28398 PE=4 SV=1 |
| COX6_YEAST | 72.072% | 111 | 1.19e-42 | Cytochrome c oxidase subunit 6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9993
Predicted cleavage: 37
Protein family membership
- Cytochrome c oxidase, subunit Va/VI (IPR003204)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Residue annotation
-
Subunit Va/VIc int...
-
Subunit Va/Vb inte...
-
Subunit Va/IV inte...
-
Subunit Va/II inte...
Protein sequence
>MIA_02547_1 MSFFLRARPALLRAAARPTARAQLAAPAMIKSVRMYSSHDDESFEEFTKRFEKEFDEAYDLYEVQRVLNNAFSYDLVPAP SVLEKALQACRRVNDYPTAVRLFEGLKVKVETKEQYQQYLDELKDIRQELGVDLSEELFA
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
GO:0005743 mitochondrial inner membrane