Protein

MCA_02980_1

Length
144 amino acids


Gene name: COX6

Description: Cytochrome c oxidase subunit 6, mitochondrial

Browser: contigB:3000090-3000937+

RNA-seq: read pairs 42405, FPKM 3613.5, percentile rank 98.9% (100% = highest expression)

Protein function

Annotation:COX6Cytochrome c oxidase subunit 6, mitochondrial
KEGG:K02264COX5A cytochrome c oxidase subunit 5a
EGGNOG:0PQ4GCOX6cytochrome C oxidase
SGD closest match:S000001093COX6Cytochrome c oxidase subunit 6, mitochondrial
CGD closest match:CAL0000187468COX6Cytochrome c oxidase subunit VI

Protein alignments

%idAln lengthE-value
MIA_02547_187.07%1162e-68MIA_02547_1
A0A0J9X695_GEOCN80.00%1151e-62Similar to Saccharomyces cerevisiae YHR051W COX6 Subunit VI of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA03s05015g PE=4 SV=1
Q6C6E6_YARLI70.54%1293e-59YALI0E10144p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10144g PE=4 SV=1
A0A060T2A3_BLAAD73.55%1217e-59ARAD1A00440p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00440g PE=4 SV=1
A0A1E3PER3_9ASCO81.13%1067e-58COX5A-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48240 PE=4 SV=1
A0A1D8PH08_CANAL74.17%1201e-57Cytochrome c oxidase subunit VI OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX6 PE=4 SV=1
UniRef50_A0A1D8PH0874.17%1203e-54Cytochrome c oxidase subunit VI n=108 Tax=Opisthokonta TaxID=33154 RepID=A0A1D8PH08_CANAL
COX6_YEAST67.50%1202e-50Cytochrome c oxidase subunit 6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX6 PE=1 SV=1
A0A1E4TB32_9ASCO71.96%1079e-51Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28398 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9858
Predicted cleavage: 42

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF48479 (Cytochrom...)
    2. cd00923 (Cyt_c_Oxid...)
    3. PF02284 (COX5A)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. Subunit Va/VIc int...
  2. Subunit Va/Vb inte...
  3. Subunit Va/IV inte...
  4. Subunit Va/II inte...

Protein sequence

>MCA_02980_1
MSFILRARPALAVASRAALRPNLAATRAVAAPTFMKSVRMYSSHEETFDEFTARFEKEFEEAYDLYEVQRVLNNVFSYDL
VPAPSVLEKALQACRRVNDYATAVRLFEGLKVKVETKEQYQQYLDELKDIRTELGVDLAEDLFH

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004129 cytochrome-c oxidase activity

Cellular Component

GO:0005743 mitochondrial inner membrane