Protein
MIA_02546_1
Length
74 amino acids
Browser: contig03:1094618-1094888+
Protein function
| EGGNOG: | 0PQMN | FG07476.1 | Transcription elongation factor |
|---|---|---|---|
| SGD closest match: | S000001643 | ELF1 | Transcription elongation factor 1 |
| CGD closest match: | CAL0000182458 | CAALFM_CR05910WA | Transcription elongation factor 1 homolog |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X655_GEOCN | 90.698% | 43 | 4.54e-24 | Transcription elongation factor 1 homolog OS=Geotrichum candidum GN=BN980_GECA03s05004g PE=3 SV=1 |
| Q6C6E7_YARLI | 75.472% | 53 | 8.17e-24 | Transcription elongation factor 1 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10131g PE=3 SV=2 |
| MCA_02981_1 | 73.077% | 52 | 7.74e-22 | MCA_02981_1 |
| A0A1E3PSQ0_9ASCO | 64.286% | 56 | 7.37e-21 | Transcription elongation factor 1 homolog (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20620 PE=3 SV=1 |
| A0A060TAV8_BLAAD | 64.151% | 53 | 3.92e-20 | Transcription elongation factor 1 homolog OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D29216g PE=3 SV=1 |
| A0A1E4TJS9_9ASCO | 69.565% | 46 | 5.33e-20 | Transcription elongation factor 1 homolog OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_80670 PE=3 SV=1 |
| Q59PU1_CANAL | 50.000% | 56 | 1.79e-18 | Transcription elongation factor 1 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR05910WA PE=3 SV=1 |
| UniRef50_I2JXX7 | 61.404% | 57 | 4.10e-15 | Transcription elongation factor 1 homolog n=2 Tax=Saccharomycetales TaxID=4892 RepID=I2JXX7_DEKBR |
| ELF1_YEAST | 67.568% | 37 | 4.01e-15 | Transcription elongation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELF1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0887
Protein family membership
- Transcription elongation factor 1 (IPR007808)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
SSF57783 (Zinc beta...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_02546_1 MGIGTLTCKVCGQSFQASINALSEPIDVYCEWVDACEAVAKKGEEDNDDEYGETQSSGRRKPSSDDEDEEDDLF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.