Protein
MCA_02981_1
Length
153 amino acids
Browser: contigB:3001319-3002063-
RNA-seq: read pairs 3601, FPKM 288.9, percentile rank 91.5% (100% = highest expression)
Protein function
EGGNOG: | 0PQMN | FG07476.1 | Transcription elongation factor |
---|---|---|---|
SGD closest match: | S000001643 | ELF1 | Transcription elongation factor 1 |
CGD closest match: | CAL0000182458 | CAALFM_CR05910WA | Transcription elongation factor 1 homolog |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A060TAV8_BLAAD | 83.33% | 84 | 5e-49 | Transcription elongation factor 1 homolog OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D29216g PE=3 SV=1 |
A0A1E3PSQ0_9ASCO | 81.25% | 80 | 1e-45 | Transcription elongation factor 1 homolog (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20620 PE=3 SV=1 |
A0A0J9X655_GEOCN | 77.27% | 88 | 2e-44 | Transcription elongation factor 1 homolog OS=Geotrichum candidum GN=BN980_GECA03s05004g PE=3 SV=1 |
Q59PU1_CANAL | 63.04% | 92 | 1e-42 | Transcription elongation factor 1 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR05910WA PE=3 SV=1 |
UniRef50_A0A1E4TQC3 | 64.89% | 94 | 9e-39 | Transcription elongation factor 1 homolog n=9 Tax=Fungi TaxID=4751 RepID=A0A1E4TQC3_PACTA |
Q6C6E7_YARLI | 76.14% | 88 | 9e-42 | Transcription elongation factor 1 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10131g PE=3 SV=2 |
A0A1E4TJS9_9ASCO | 73.49% | 83 | 6e-42 | Transcription elongation factor 1 homolog OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_80670 PE=3 SV=1 |
ELF1_YEAST | 66.25% | 80 | 2e-35 | Transcription elongation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELF1 PE=1 SV=1 |
MIA_02546_1 | 73.08% | 52 | 1e-20 | MIA_02546_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2324
Protein family membership
- Transcription elongation factor 1 (IPR007808)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
SSF57783 (Zinc beta...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_02981_1 MTIVFLNTSKIYDRLSEMGKRKKSSRGPAKKVKQTLDTTFSCLFCNHEKSVVATLDKKIGIGSLLCKVCGQTFQASVNAL SEPIDVYSEWVDACEAVAKNPDPAGGEEEDLSDTEARDQEEEDEDRPTNSRTSSRLPRSQVNDYDDDDDDDLF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.