Protein
MIA_02511_1
Length
144 amino acids
Browser: contig03:1012185-1012728-
Protein function
| EGGNOG: | 0PSIP | SOH1 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
|---|---|---|---|
| SGD closest match: | S000003095 | SOH1 | Mediator of RNA polymerase II transcription subunit 31 |
| CGD closest match: | CAL0000190883 | SOH1 | Mediator of RNA polymerase II transcription subunit 31 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01403_1 | 76.042% | 96 | 1.99e-39 | MCA_01403_1 |
| A0A0J9XA72_GEOCN | 70.833% | 96 | 2.27e-38 | Similar to Saccharomyces cerevisiae YGL127C SOH1 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA06s04740g PE=4 SV=1 |
| A0A1E3PFH0_9ASCO | 63.366% | 101 | 3.78e-36 | SOH1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27565 PE=4 SV=1 |
| UniRef50_A0A1E3PFH0 | 63.366% | 101 | 1.03e-32 | SOH1-domain-containing protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PFH0_9ASCO |
| A0A060THA1_BLAAD | 70.213% | 94 | 1.38e-34 | ARAD1D28798p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D28798g PE=4 SV=1 |
| MED31_YARLI | 66.667% | 93 | 3.80e-30 | Mediator of RNA polymerase II transcription subunit 31 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SOH1 PE=3 SV=1 |
| A0A1E4TCX4_9ASCO | 58.095% | 105 | 1.94e-30 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4207 PE=4 SV=1 |
| MED31_CANAL | 53.000% | 100 | 2.20e-27 | Mediator of RNA polymerase II transcription subunit 31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOH1 PE=3 SV=1 |
| MED31_YEAST | 48.315% | 89 | 3.56e-12 | Mediator of RNA polymerase II transcription subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOH1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0116
Protein family membership
- Mediator complex, subunit Med31 (IPR008831)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_02511_1 MNESQVEQSQEPQPAVDLPNRWEVELEFVQSLANPHYLNYLAQNKYLESEEFLNFLEYLEYWREPKYAKYIVYPNCLHVL SLLKEPRFQKDIAREDVSTMFMDDFYMRWLKKAANPDEDIEKMATKTQSTTEPTTTNIKTEQDQ
GO term prediction
Biological Process
GO:0006355 regulation of transcription, DNA-templated
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex