Protein
MCA_01403_1
Length
138 amino acids
Gene name: SOH1
Description: Mediator of RNA polymerase II transcription subunit 31
Browser: contigA:4372665-4373224-
RNA-seq: read pairs 468, FPKM 41.6, percentile rank 61.2% (100% = highest expression)
Protein function
| Annotation: | SOH1 | Mediator of RNA polymerase II transcription subunit 31 | |
|---|---|---|---|
| KEGG: | K15153 | MED31 | mediator of RNA polymerase II transcription subunit 31 |
| EGGNOG: | 0PSIP | SOH1 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
| SGD closest match: | S000003095 | SOH1 | Mediator of RNA polymerase II transcription subunit 31 |
| CGD closest match: | CAL0000190883 | SOH1 | Mediator of RNA polymerase II transcription subunit 31 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02511_1 | 72.55% | 102 | 2e-52 | MIA_02511_1 |
| A0A0J9XA72_GEOCN | 58.33% | 120 | 2e-46 | Similar to Saccharomyces cerevisiae YGL127C SOH1 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA06s04740g PE=4 SV=1 |
| A0A1E3PFH0_9ASCO | 62.96% | 108 | 1e-45 | SOH1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27565 PE=4 SV=1 |
| UniRef50_A0A1E3PFH0 | 62.96% | 108 | 4e-42 | SOH1-domain-containing protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PFH0_9ASCO |
| MED31_YARLI | 60.34% | 116 | 2e-45 | Mediator of RNA polymerase II transcription subunit 31 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SOH1 PE=3 SV=1 |
| A0A060THA1_BLAAD | 68.48% | 92 | 5e-41 | ARAD1D28798p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D28798g PE=4 SV=1 |
| A0A1E4TCX4_9ASCO | 56.36% | 110 | 1e-39 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4207 PE=4 SV=1 |
| MED31_CANAL | 52.53% | 99 | 3e-33 | Mediator of RNA polymerase II transcription subunit 31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOH1 PE=3 SV=1 |
| MED31_YEAST | 47.78% | 90 | 7e-20 | Mediator of RNA polymerase II transcription subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOH1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0265
Protein family membership
- Mediator complex, subunit Med31 (IPR008831)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_01403_1 MDQAEPVLPPPSRWEVELEFVQSLANPKYLNFLAQNKYLENPEFLNFLEYLEYWREPKYAKFLVYPNCLHILSLLKIPQF RLEIAREDLAVRFMDEFYMKWLNGSGQDLNAITESINENLKSNNSEEPSEIKPKTEEN
GO term prediction
Biological Process
GO:0006355 regulation of transcription, DNA-templated
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex