Protein

MCA_01403_1

Length
138 amino acids


Gene name: SOH1

Description: Mediator of RNA polymerase II transcription subunit 31

Browser: contigA:4372665-4373224-

RNA-seq: read pairs 468, FPKM 41.6, percentile rank 61.2% (100% = highest expression)

Protein function

Annotation:SOH1Mediator of RNA polymerase II transcription subunit 31
KEGG:K15153MED31 mediator of RNA polymerase II transcription subunit 31
EGGNOG:0PSIPSOH1Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
SGD closest match:S000003095SOH1Mediator of RNA polymerase II transcription subunit 31
CGD closest match:CAL0000190883SOH1Mediator of RNA polymerase II transcription subunit 31

Protein alignments

%idAln lengthE-value
MIA_02511_172.55%1022e-52MIA_02511_1
A0A0J9XA72_GEOCN58.33%1202e-46Similar to Saccharomyces cerevisiae YGL127C SOH1 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA06s04740g PE=4 SV=1
A0A1E3PFH0_9ASCO62.96%1081e-45SOH1-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27565 PE=4 SV=1
UniRef50_A0A1E3PFH062.96%1084e-42SOH1-domain-containing protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PFH0_9ASCO
MED31_YARLI60.34%1162e-45Mediator of RNA polymerase II transcription subunit 31 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SOH1 PE=3 SV=1
A0A060THA1_BLAAD68.48%925e-41ARAD1D28798p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D28798g PE=4 SV=1
A0A1E4TCX4_9ASCO56.36%1101e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4207 PE=4 SV=1
MED31_CANAL52.53%993e-33Mediator of RNA polymerase II transcription subunit 31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOH1 PE=3 SV=1
MED31_YEAST47.78%907e-20Mediator of RNA polymerase II transcription subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOH1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0265

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Protein sequence

>MCA_01403_1
MDQAEPVLPPPSRWEVELEFVQSLANPKYLNFLAQNKYLENPEFLNFLEYLEYWREPKYAKFLVYPNCLHILSLLKIPQF
RLEIAREDLAVRFMDEFYMKWLNGSGQDLNAITESINENLKSNNSEEPSEIKPKTEEN

GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-templated

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex