Protein

MIA_02509_1

Length
308 amino acids


Browser: contig03:1008007-1008934+

Protein function

EGGNOG:0PQPTMIA40Required for the import and folding of small cysteine- containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Forms a redox cycle with ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS
SGD closest match:S000001678MIA40Mitochondrial intermembrane space import and assembly protein 40
CGD closest match:CAL0000191454MIA40Mitochondrial intermembrane space import and assembly protein 40

Protein alignments

%idAln lengthE-value
MCA_05346_192.754%692.55e-46MCA_05346_1
A0A0J9XJE1_GEOCN92.537%671.30e-44Similar to Saccharomyces cerevisiae YKL195W MIA40 Essential protein of the mitochondrial intermembrane space (IMS) OS=Geotrichum candidum GN=BN980_GECA19s00208g PE=4 SV=1
UniRef50_A0A0J9XJE192.537%672.67e-41Similar to Saccharomyces cerevisiae YKL195W MIA40 Essential protein of the mitochondrial intermembrane space (IMS) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJE1_GEOCN
MIA40_YEAST80.282%711.85e-41Mitochondrial intermembrane space import and assembly protein 40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIA40 PE=1 SV=2
A0A1E3PN12_9ASCO80.882%687.38e-41Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41307 PE=4 SV=1
Q6C535_YARLI84.848%663.27e-41YALI0E21373p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21373g PE=4 SV=1
A0A161HMT3_9ASCO79.710%693.98e-41Mia40p OS=Sugiyamaella lignohabitans GN=MIA40 PE=4 SV=1
A0A1E4TD07_9ASCO82.353%681.28e-41Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32822 PE=4 SV=1
A0A060SYP7_BLAAD81.818%667.31e-39ARAD1A18656p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A18656g PE=4 SV=1
MIA40_CANAL78.462%652.67e-37Mitochondrial intermembrane space import and assembly protein 40 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MIA40 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9994
Predicted cleavage: 69

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 308

Detailed signature matches

    1. PF06747 (CHCH)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PS51808 (CHCH)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_02509_1
MFRATSSILRSTAARSVSRRLSPSAVMAYSTRASSSSASSTRLWLGATAALLGAGVVATQLSASPIRLESKSESSSSSST
DKPSVSEAVLTVVDTVSSSKDNLVSTAVDAAVEAADAAAAQAGIEDAVVAAVQGVDSAVQALSEDLSNELEELSQEYKKE
AEDLAAEAAGAAAGAEAAEPEEAAVPNKGAFDPDTGEINWDCPCLGGMAHGPCGEEFKTAFSCFVYSEAEPKGIDCIEKF
SAMQNCFREHPDVYAEELRETEPFPEETSQVPAEEVEAVIVEAIPVEPVALEIVEEVIPVEQASSKSN

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.