Protein
MCA_05346_1
Length
287 amino acids
Gene name: MIA40
Description: Mitochondrial intermembrane space import and assembly protein 40
Browser: contigD:1075098-1075962+
RNA-seq: read pairs 3987, FPKM 171.1, percentile rank 86.3% (100% = highest expression)
Protein function
| Annotation: | MIA40 | Mitochondrial intermembrane space import and assembly protein 40 | |
|---|---|---|---|
| KEGG: | K17782 | MIA40 | mitochondrial intermembrane space import and assembly protein 40 |
| EGGNOG: | 0PQPT | MIA40 | Required for the import and folding of small cysteine- containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Forms a redox cycle with ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS |
| SGD closest match: | S000001678 | MIA40 | Mitochondrial intermembrane space import and assembly protein 40 |
| CGD closest match: | CAL0000191454 | MIA40 | Mitochondrial intermembrane space import and assembly protein 40 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02509_1 | 69.31% | 101 | 5e-46 | MIA_02509_1 |
| UniRef50_W1QJX1 | 69.07% | 97 | 3e-40 | Mitochondrial intermembrane space import and assembly protein 40 n=2 Tax=Ogataea TaxID=461281 RepID=W1QJX1_OGAPD |
| A0A1E3PN12_9ASCO | 67.74% | 93 | 1e-40 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41307 PE=4 SV=1 |
| Q6C535_YARLI | 85.51% | 69 | 1e-41 | YALI0E21373p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21373g PE=4 SV=1 |
| A0A0J9XJE1_GEOCN | 85.07% | 67 | 4e-40 | Similar to Saccharomyces cerevisiae YKL195W MIA40 Essential protein of the mitochondrial intermembrane space (IMS) OS=Geotrichum candidum GN=BN980_GECA19s00208g PE=4 SV=1 |
| A0A1E4TD07_9ASCO | 84.06% | 69 | 2e-41 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32822 PE=4 SV=1 |
| MIA40_YEAST | 74.12% | 85 | 5e-39 | Mitochondrial intermembrane space import and assembly protein 40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIA40 PE=1 SV=2 |
| A0A161HMT3_9ASCO | 78.26% | 69 | 3e-39 | Mia40p OS=Sugiyamaella lignohabitans GN=MIA40 PE=4 SV=1 |
| A0A060SYP7_BLAAD | 84.85% | 66 | 5e-39 | ARAD1A18656p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A18656g PE=4 SV=1 |
| MIA40_CANAL | 72.06% | 68 | 2e-34 | Mitochondrial intermembrane space import and assembly protein 40 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MIA40 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9975
Predicted cleavage: 46
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
-
NON_CYTOPLASM... (N...)
-
PS51808 (CHCH)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05346_1 MYRANTLRRLSAKSAGLRSVAGSLRSGSVSNVARFSTMPKTSARNSSSHLLVGGACAFTVGLIGYNSYFKSEKILLDDGK IEKTAEPVMEEVVVIEESVKEDIPVITATIEETAEKLGSTIEEISEEIEKEVENIANEITEELAEAQALEEKAEEESAAQ NKGAYDPETGEINWDCPCLGGMAHGPCGEEFKTAFSCFVYSKEEPKGIDCIEKFSAMQNCFREHPEVYAEELRETEPFPE EDDKSKSAPSNEDVSAKPVEESKPAAEPVTEEVEPKKSKKSKKASKE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.