Protein

MIA_02432_1

Length
147 amino acids


Browser: contig03:771032-771749+

Protein function

EGGNOG:0PNASSNX3Required for retention of late Golgi membrane proteins. Component of the retrieval machinery that functions by direct interaction with the cytosolic tails of certain TGN membrane proteins during the sorting budding process at the prevacuolar compartment. Binds phosphatidylinositol 3-phosphate (PtdIns(P3))
SGD closest match:S000005884SNX3Sorting nexin-3
CGD closest match:CAL0000191797SNX3Sorting nexin-3

Protein alignments

%idAln lengthE-value
MCA_04066_294.068%1188.57e-82MCA_04066_2
A0A0J9XGB5_GEOCN92.308%1172.41e-78Similar to Saccharomyces cerevisiae YOR357C SNX3 Sorting nexin required to maintain late-Golgi resident enzymes in their proper location by recycling molecules from the prevacuolar compartment OS=Geotrichum candidum GN=BN980_GECA15s00125g PE=4 SV=1
A0A060TAH4_BLAAD92.105%1145.70e-75ARAD1D19250p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19250g PE=4 SV=1
SNX3_YARLI86.364%1106.31e-70Sorting nexin-3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNX3 PE=3 SV=1
UniRef50_Q6C2S986.364%1101.46e-66Sorting nexin-3 n=78 Tax=Fungi TaxID=4751 RepID=SNX3_YARLI
A0A1E3PS44_9ASCO81.739%1159.07e-70Putative sorting nexin Snx3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44786 PE=4 SV=1
A0A1E4TC57_9ASCO82.456%1141.06e-67Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28864 PE=4 SV=1
SNX3_CANAL61.600%1254.15e-51Sorting nexin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNX3 PE=3 SV=2
SNX3_YEAST54.783%1151.59e-37Sorting nexin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNX3 PE=1 SV=1
A0A167CBU5_9ASCO34.066%912.30e-10Vps5p OS=Sugiyamaella lignohabitans GN=VPS5 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2199
Predicted cleavage: 28

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 147

Detailed signature matches

    1. SM00312 (PX_2)
    2. SSF64268 (PX domain)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_02432_1
MSSSNDTSKPSQVSSSSRPFASMSDRLHTSNISFEARPEIKQQTFDEIYGVPENFLEIEVRNPQTHGFARKMYTDYEIIC
RTNIPAFKLKTSSVRRRYSDFECFRDILERETTRVTIPALPGKVFTNRFSDEVIEHRREGLERFLQM

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0035091 phosphatidylinositol binding

Cellular Component

None predicted.