Protein

MCA_04066_2

Length
177 amino acids


Gene name: SNX3

Description: Sorting nexin-3

Browser: contigC:1937371-1938191+

RNA-seq: read pairs 5641, FPKM 391.6, percentile rank 93.4% (100% = highest expression)

Protein function

Annotation:SNX3Sorting nexin-3
KEGG:K17918SNX3_12 sorting nexin-3/12
EGGNOG:0PNASSNX3Required for retention of late Golgi membrane proteins. Component of the retrieval machinery that functions by direct interaction with the cytosolic tails of certain TGN membrane proteins during the sorting budding process at the prevacuolar compartment. Binds phosphatidylinositol 3-phosphate (PtdIns(P3))
SGD closest match:S000005884SNX3Sorting nexin-3
CGD closest match:CAL0000191797SNX3Sorting nexin-3

Protein alignments

%idAln lengthE-value
A0A0J9XGB5_GEOCN90.41%1464e-98Similar to Saccharomyces cerevisiae YOR357C SNX3 Sorting nexin required to maintain late-Golgi resident enzymes in their proper location by recycling molecules from the prevacuolar compartment OS=Geotrichum candidum GN=BN980_GECA15s00125g PE=4 SV=1
A0A1E3PS44_9ASCO70.06%1771e-90Putative sorting nexin Snx3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44786 PE=4 SV=1
SNX3_YARLI81.46%1519e-91Sorting nexin-3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNX3 PE=3 SV=1
UniRef50_Q6C2S981.46%1512e-87Sorting nexin-3 n=78 Tax=Fungi TaxID=4751 RepID=SNX3_YARLI
A0A1E4TC57_9ASCO82.64%1443e-88Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28864 PE=4 SV=1
MIA_02432_190.00%1302e-82MIA_02432_1
A0A060TAH4_BLAAD84.50%1292e-74ARAD1D19250p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19250g PE=4 SV=1
SNX3_CANAL60.90%1563e-65Sorting nexin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNX3 PE=3 SV=2
SNX3_YEAST56.93%1372e-46Sorting nexin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNX3 PE=1 SV=1
A0A167D465_9ASCO34.19%1179e-14Snx4p OS=Sugiyamaella lignohabitans GN=SNX4 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0806

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 177

Detailed signature matches

    1. SM00312 (PX_2)
    2. SSF64268 (PX domain)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd07295 (PX_Grd19)
  2. mobidb-lite (disord...)

Residue annotation

  1. phosphoinositide b...

Protein sequence

>MCA_04066_2
MTSNQVSSPTNKNTPESSKSRAFASIPDRPSNLSFEARPEIKQQTFDEIYGVPENFLEIEVRNPQTHGYGRKMYTDYEII
CRTNIPAFKLKSSSVRRRYSDFECFRDILERETSRVTIPALPGKVFTNRFSDEVIENRREGLERFLQIVAGHPLLQTGSN
ALAAFIQDPQWDKNQWI

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0035091 phosphatidylinositol binding

Cellular Component

None predicted.