Protein

MIA_02429_1

Length
170 amino acids


Browser: contig03:764589-765134+

Protein function

EGGNOG:0PHM8FG08895.160s ribosomal protein
SGD closest match:S000000395RPL21A60S ribosomal protein L21-A
CGD closest match:CAL0000194631RPL21ARibosomal 60S subunit protein L21A

Protein alignments

%idAln lengthE-value
MCA_04175_180.142%1411.65e-83MCA_04175_1
A0A060TF16_BLAAD73.381%1391.30e-75ARAD1D19184p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19184g PE=4 SV=1
A0A1D8PGY0_CANAL74.286%1406.88e-74Ribosomal 60S subunit protein L21A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL21A PE=4 SV=1
RL21A_YEAST73.571%1407.70e-7460S ribosomal protein L21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL21A PE=1 SV=1
UniRef50_Q0275373.571%1401.84e-7060S ribosomal protein L21-A n=132 Tax=Eukaryota TaxID=2759 RepID=RL21A_YEAST
A0A0J9XG52_GEOCN77.857%1401.44e-73Similar to Saccharomyces cerevisiae YBR191W RPL21A Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Bp OS=Geotrichum candidum GN=BN980_GECA15s00109g PE=4 SV=1
Q6C2S6_YARLI68.794%1414.55e-68YALI0F05522p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F05522g PE=4 SV=1
A0A1E3PPL6_9ASCO71.429%1401.11e-6760S ribosomal protein L21-A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50692 PE=4 SV=1
A0A1E4TBU6_9ASCO71.223%1391.14e-67Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58210 PE=4 SV=1
A0A167CWL1_9ASCO70.370%1081.02e-52Ribosomal 60S subunit protein L21B OS=Sugiyamaella lignohabitans GN=RPL21B PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0256

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 170

Detailed signature matches

    1. PF01157 (Ribosomal_...)
    1. SSF50104 (Translati...)
    1. PS01171 (RIBOSOMAL_...)

Protein sequence

>MIA_02429_1
MFALIVHDMDIQVIVILTFDFDCEIAAVTDLKNGVIPLSTYLKTYKVGDIVDIKANGSIQKGMPHKFYHGKTGIVFNVTK
SSVGVIIHKVVGNRYLEKRVNLRVEHVKHSKCRQDFLKRVTENEQKRAEAKKNGTSVVLKRQPVQPRGAAVVKVSEIPET
VTPVPYETFI

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome