Protein

MCA_04175_1

Length
161 amino acids


Browser: contigC:2278401-2279273-

RNA-seq: read pairs 53468, FPKM 4078.1, percentile rank 99.2% (100% = highest expression)

Protein function

KEGG:K02889RP-L21e large subunit ribosomal protein L21e
EGGNOG:0PHM8FG08895.160s ribosomal protein
SGD closest match:S000000395RPL21A60S ribosomal protein L21-A
CGD closest match:CAL0000194631RPL21ARibosomal 60S subunit protein L21A

Protein alignments

%idAln lengthE-value
A0A060TF16_BLAAD75.16%1619e-91ARAD1D19184p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19184g PE=4 SV=1
A0A0J9XG52_GEOCN78.88%1611e-89Similar to Saccharomyces cerevisiae YBR191W RPL21A Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl21Bp OS=Geotrichum candidum GN=BN980_GECA15s00109g PE=4 SV=1
A0A1D8PGY0_CANAL74.53%1618e-88Ribosomal 60S subunit protein L21A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL21A PE=4 SV=1
RL21A_YEAST72.05%1611e-8460S ribosomal protein L21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL21A PE=1 SV=1
UniRef50_Q0275372.05%1613e-8160S ribosomal protein L21-A n=132 Tax=Eukaryota TaxID=2759 RepID=RL21A_YEAST
A0A1E3PPL6_9ASCO75.16%1611e-8460S ribosomal protein L21-A OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50692 PE=4 SV=1
Q6C2S6_YARLI70.19%1614e-83YALI0F05522p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F05522g PE=4 SV=1
MIA_02429_180.14%1416e-82MIA_02429_1
A0A1E4TBU6_9ASCO69.57%1611e-78Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58210 PE=4 SV=1
A0A167CWL1_9ASCO67.27%1109e-52Ribosomal 60S subunit protein L21B OS=Sugiyamaella lignohabitans GN=RPL21B PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8509

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 161

Detailed signature matches

    1. PF01157 (Ribosomal_...)
    1. SSF50104 (Translati...)
    1. PS01171 (RIBOSOMAL_...)

Protein sequence

>MCA_04175_1
MGKSRGYRSGTRYAFSRDFKKHGAIPLSTYLKTYKVGDIVDIKANGAVQKGMPHKFYHGKTGIVFNVTKSSVGVLIHKIV
GNRYMEKRVNLRIEHVKHSKCRQDFLNRVVENEKKRAAAKKSGETVVLKRQPGQPREASIVKITDETLPETVAPIPYETY
I

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome