Protein

MIA_02413_1

Length
125 amino acids

Browser: contig03:733018-733576+

Protein function

EGGNOG:0PQR4PFY1Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations (By similarity)
SGD closest match:S000005648PFY1Profilin
CGD closest match:CAL0000200755PFY1Profilin

Protein alignments

%idAln lengthE-value
A0A0J9X598_GEOCN44.800%1256.51e-38Profilin OS=Geotrichum candidum GN=BN980_GECA03s00923g PE=3 SV=1
UniRef50_P3982543.307%1271.95e-32Profilin n=30 Tax=Ascomycota TaxID=4890 RepID=PROF_SCHPO
A0A060T3S8_BLAAD43.651%1262.28e-35Profilin OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39402g PE=3 SV=1
W0TYP0_YARLI42.857%1261.95e-35Profilin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07183g PE=3 SV=1
A0A1E3PM99_9ASCO43.651%1264.46e-35Profilin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50487 PE=3 SV=1
MCA_01864_142.400%1257.93e-35MCA_01864_1
Q5A786_CANAL42.063%1262.08e-33Profilin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFY1 PE=3 SV=1
PROF_YEAST39.683%1262.71e-32Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFY1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6747
Predicted cleavage: 25

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR005455
    Profilin
    1. PF00235 (Profilin)
    2. SM00392 (prof_2)
    3. PR00392 (PROFILIN)
    4. cd00148 (PROF)
    5. SSF55770 (Profilin ...)
    6. PR01640 (PROFILINPLNT)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.45...

Residue annotation

  1. poly-proline bindi...
  2. actin interaction ...
  3. putative PIP2-inte...

Protein sequence

>MIA_02413_1
MALIGYIDTLAQSHIARSAIISRDGSSIWAISSDFKLSPTEMSEIAQAFDNPAKVLGSGVHANGQKFFTLSVDDRIIRAQ
MQNKGIIAIRTKQAILISNYDEKIIPVQAATVTERLADYLIGLNY

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.