Protein
MCA_01864_1
Length
125 amino acids
Gene name: PFY1
Description: Profilin
Browser: contigA:5721034-5721879+
RNA-seq: read pairs 12495, FPKM 1225.3, percentile rank 97.0% (100% = highest expression)
Protein function
Annotation: | PFY1 | Profilin | |
---|---|---|---|
KEGG: | K05759 | PFN | profilin |
EGGNOG: | 0PQR4 | PFY1 | Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations (By similarity) |
SGD closest match: | S000005648 | PFY1 | Profilin |
CGD closest match: | CAL0000200755 | PFY1 | Profilin |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X598_GEOCN | 71.20% | 125 | 2e-60 | Profilin OS=Geotrichum candidum GN=BN980_GECA03s00923g PE=3 SV=1 |
UniRef50_A0A1V2L4N1 | 62.70% | 126 | 8e-47 | Profilin n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2L4N1_CYBFA |
A0A060T3S8_BLAAD | 61.90% | 126 | 2e-52 | Profilin OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39402g PE=3 SV=1 |
W0TYP0_YARLI | 59.52% | 126 | 1e-50 | Profilin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B07183g PE=3 SV=1 |
A0A1E3PM99_9ASCO | 59.52% | 126 | 6e-50 | Profilin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50487 PE=3 SV=1 |
Q5A786_CANAL | 58.73% | 126 | 1e-49 | Profilin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFY1 PE=3 SV=1 |
PROF_YEAST | 55.56% | 126 | 1e-49 | Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFY1 PE=1 SV=2 |
MIA_02413_1 | 42.40% | 125 | 1e-33 | MIA_02413_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0291
Protein family membership
- Profilin (IPR005455)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
Residue annotation
-
poly-proline bindi...
-
actin interaction ...
-
putative PIP2-inte...
Protein sequence
>MCA_01864_1 MSWLGYVDSLKAAGLDQAAIYSKAGDSVWAQSDGFNISASEIQELVKGFDNPSGLQASGLHIQGQKYFLLRADERSIYGK YEDTGIIAVKTNLAIIIAHYGPSIQAGSAATAVEKVADHLIKLNY
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.