MIA_02395_1

Browser: contig03:683632-684789-

Protein function

EGGNOG:	0PJIQ	ATP4	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements
SGD closest match:	S000005999	ATP4	ATP synthase subunit 4, mitochondrial
CGD closest match:	CAL0000200090	ATP4	F1F0 ATP synthase subunit 4

Protein alignments

	%id	Aln length	E-value
MCA_04187_1	78.903%	237	2.47e-135	MCA_04187_1
A0A0J9X876_GEOCN	73.840%	237	3.08e-122	Similar to Saccharomyces cerevisiae YPL078C ATP4 Subunit b of the stator stalk of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s01781g PE=4 SV=1
A0A167D550_9ASCO	61.712%	222	7.17e-99	F1F0 ATP synthase subunit 4 OS=Sugiyamaella lignohabitans GN=ATP4 PE=4 SV=1
A0A060TCW4_BLAAD	55.556%	243	4.18e-89	ARAD1D39050p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39050g PE=4 SV=1
A0A1E3PME4_9ASCO	53.586%	237	2.32e-84	Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82204 PE=4 SV=1
A0A1E4TD18_9ASCO	54.630%	216	4.25e-80	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32808 PE=4 SV=1
Q6C105_YARLI	54.854%	206	7.76e-79	YALI0F20306p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F20306g PE=4 SV=1
Q59ZE0_CANAL	52.119%	236	2.17e-76	F1F0 ATP synthase subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP4 PE=4 SV=1
ATPF_YEAST	47.934%	242	4.77e-74	ATP synthase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP4 PE=1 SV=2
UniRef50_P05626	47.934%	242	1.14e-70	ATP synthase subunit 4, mitochondrial n=83 Tax=Saccharomycetales TaxID=4892 RepID=ATPF_YEAST

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9815
Predicted cleavage: 41

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MIA_02395_1
MSLRVASRSLALASRPVLARPVVGAAPIALRRLYSSEADPKAKASSILSALPGNSLVSKTGFLATLTAAGVYTISNGLYV
VNAETCIVSVFGVLLIVISKTVAPAYKEWAEGYIENVKNVLNSARDTHTLAVKERIESVSKVKDVVAITENLFKASKETV
ELEAKAFELKQQVAFAHEAKSVLDSWVRYEAQVRKKEQEALAKSVIDKVNSQVADSAFQAKVLKQAIADVEKIFSKA

GO term prediction