MCA_04187_1

Gene name: ATP4

Description: ATP synthase subunit 4, mitochondrial

Browser: contigC:2304826-2306344-

RNA-seq: read pairs 30622, FPKM 1596.5, percentile rank 97.5% (100% = highest expression)

Protein function

Annotation:		ATP4	ATP synthase subunit 4, mitochondrial
KEGG:	K02127	ATPeF0B	F-type H+-transporting ATPase subunit b
EGGNOG:	0PJIQ	ATP4	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements
SGD closest match:	S000005999	ATP4	ATP synthase subunit 4, mitochondrial
CGD closest match:	CAL0000200090	ATP4	F1F0 ATP synthase subunit 4

Protein alignments

	%id	Aln length	E-value
MIA_02395_1	79.63%	216	8e-115	MIA_02395_1
A0A0J9X8H1_GEOCN	72.64%	212	2e-103	Similar to Saccharomyces cerevisiae YPL078C ATP4 Subunit b of the stator stalk of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s02595g PE=4 SV=1
A0A167D550_9ASCO	60.65%	216	2e-84	F1F0 ATP synthase subunit 4 OS=Sugiyamaella lignohabitans GN=ATP4 PE=4 SV=1
A0A060TCW4_BLAAD	58.14%	215	1e-80	ARAD1D39050p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39050g PE=4 SV=1
Q6C105_YARLI	56.80%	206	4e-74	YALI0F20306p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F20306g PE=4 SV=1
UniRef50_A0A1V2LI15	56.81%	213	4e-66	ATP synthase subunit 4, mitochondrial n=1 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1V2LI15_PICKU
A0A1E3PME4_9ASCO	53.27%	214	1e-71	Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82204 PE=4 SV=1
A0A1E4TD18_9ASCO	53.70%	216	3e-70	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32808 PE=4 SV=1
ATPF_YEAST	51.39%	216	2e-68	ATP synthase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP4 PE=1 SV=2
Q59ZE0_CANAL	53.33%	210	6e-66	F1F0 ATP synthase subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP4 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9733
Predicted cleavage: 34

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MCA_04187_1
MSLRASTRTLALAARPMLARPIVGAAPSMIRLYSSEADPKAKASSILAALPGNNLVSKTSILATAAAAGVYTISNGLYVV
NAETCIASVFCALIVVISKTVAPAYKEWAESYIENVKSVLNKARETHTHAVKERIENVNKLKDVVGITENLFKVSKETVA
LEAEAFELKQKVAFAAEAKSVLDSWVRYEAQVRKKEQEALAKTIISKIESEISSPAFQSKALKQAVAEVEKIFSKA

GO term prediction