Protein
MCA_04187_1
Length
236 amino acids
Gene name: ATP4
Description: ATP synthase subunit 4, mitochondrial
Browser: contigC:2304826-2306344-
RNA-seq: read pairs 30622, FPKM 1596.5, percentile rank 97.5% (100% = highest expression)
Protein function
| Annotation: | ATP4 | ATP synthase subunit 4, mitochondrial | |
|---|---|---|---|
| KEGG: | K02127 | ATPeF0B | F-type H+-transporting ATPase subunit b |
| EGGNOG: | 0PJIQ | ATP4 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements |
| SGD closest match: | S000005999 | ATP4 | ATP synthase subunit 4, mitochondrial |
| CGD closest match: | CAL0000200090 | ATP4 | F1F0 ATP synthase subunit 4 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02395_1 | 79.63% | 216 | 8e-115 | MIA_02395_1 |
| A0A0J9X8H1_GEOCN | 72.64% | 212 | 2e-103 | Similar to Saccharomyces cerevisiae YPL078C ATP4 Subunit b of the stator stalk of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA05s02595g PE=4 SV=1 |
| A0A167D550_9ASCO | 60.65% | 216 | 2e-84 | F1F0 ATP synthase subunit 4 OS=Sugiyamaella lignohabitans GN=ATP4 PE=4 SV=1 |
| A0A060TCW4_BLAAD | 58.14% | 215 | 1e-80 | ARAD1D39050p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39050g PE=4 SV=1 |
| Q6C105_YARLI | 56.80% | 206 | 4e-74 | YALI0F20306p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F20306g PE=4 SV=1 |
| UniRef50_A0A1V2LI15 | 56.81% | 213 | 4e-66 | ATP synthase subunit 4, mitochondrial n=1 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1V2LI15_PICKU |
| A0A1E3PME4_9ASCO | 53.27% | 214 | 1e-71 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82204 PE=4 SV=1 |
| A0A1E4TD18_9ASCO | 53.70% | 216 | 3e-70 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32808 PE=4 SV=1 |
| ATPF_YEAST | 51.39% | 216 | 2e-68 | ATP synthase subunit 4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP4 PE=1 SV=2 |
| Q59ZE0_CANAL | 53.33% | 210 | 6e-66 | F1F0 ATP synthase subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP4 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9733
Predicted cleavage: 34
Protein family membership
- ATP synthase, F0 complex, subunit B/MI25 (IPR008688)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05405 (Mt_ATP-synt_B)
-
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SSF161060 (ATP synt...)
Protein sequence
>MCA_04187_1 MSLRASTRTLALAARPMLARPIVGAAPSMIRLYSSEADPKAKASSILAALPGNNLVSKTSILATAAAAGVYTISNGLYVV NAETCIASVFCALIVVISKTVAPAYKEWAESYIENVKSVLNKARETHTHAVKERIENVNKLKDVVGITENLFKVSKETVA LEAEAFELKQKVAFAAEAKSVLDSWVRYEAQVRKKEQEALAKTIISKIESEISSPAFQSKALKQAVAEVEKIFSKA
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)