Protein
MIA_02354_1
Length
111 amino acids
Browser: contig03:555993-556548+
Protein function
| EGGNOG: | 0PPMK | TOA2 | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation (By similarity) |
|---|---|---|---|
| SGD closest match: | S000001541 | TOA2 | Transcription initiation factor IIA subunit 2 |
| CGD closest match: | CAL0000177370 | TOA2 | Transcription initiation factor IIA subunit 2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01808_1 | 73.874% | 111 | 4.16e-62 | MCA_01808_1 |
| A0A060T2Z1_BLAAD | 61.818% | 110 | 7.23e-52 | Transcription initiation factor IIA subunit 2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04928g PE=3 SV=1 |
| A0A1E3PEY9_9ASCO | 64.815% | 108 | 1.65e-50 | Transcription initiation factor IIA subunit 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53127 PE=3 SV=1 |
| UniRef50_H6BRR6 | 58.182% | 110 | 1.03e-41 | Transcription initiation factor IIA subunit 2 n=42 Tax=Fungi TaxID=4751 RepID=H6BRR6_EXODN |
| A0A0J9X8I9_GEOCN | 58.654% | 104 | 2.88e-44 | Transcription initiation factor IIA subunit 2 OS=Geotrichum candidum GN=BN980_GECA05s06445g PE=3 SV=1 |
| A0A1E4TC03_9ASCO | 56.140% | 114 | 1.04e-37 | Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45736 PE=4 SV=1 |
| Q6C0S4_YARLI | 48.182% | 110 | 1.34e-38 | Transcription initiation factor IIA subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F22136g PE=3 SV=1 |
| Q5AMM1_CANAL | 45.736% | 129 | 1.55e-35 | Transcription initiation factor IIA subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOA2 PE=3 SV=1 |
| T2AG_YEAST | 46.281% | 121 | 5.30e-34 | Transcription initiation factor IIA subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOA2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1584
Protein family membership
Domains and repeats
-
Domain
1
20
40
60
80
100
111
Detailed signature matches
-
-
PIRSF009415 (TFIIA_...)
-
-
-
SSF47396 (Transcrip...)
-
-
-
SSF50784 (Transcrip...)
-
-
no IPR
Unintegrated signatures
Residue annotation
-
TFIIA subunit inte...
-
TFIIA subunit inte...
-
TBP interface cd10...
Protein sequence
>MIA_02354_1 MSSTQYYELYRRSSVGTALEDTLDYLISNALIEPQLAVKTLTRFDQVIAEQIHHQVKARCTVRGHLHTYRCCDDVWTFVV KNANFRMEDGIVENAEKIKIVACNSKKSGEQ
GO term prediction
Biological Process
GO:0006367 transcription initiation from RNA polymerase II promoter
Molecular Function
None predicted.
Cellular Component
GO:0005672 transcription factor TFIIA complex