Protein
MCA_01808_1
Length
111 amino acids
Gene name: TOA2
Description: Transcription initiation factor IIA subunit 2
Browser: contigA:5504687-5505129-
RNA-seq: read pairs 1553, FPKM 171.3, percentile rank 86.4% (100% = highest expression)
Protein function
Annotation: | TOA2 | Transcription initiation factor IIA subunit 2 | |
---|---|---|---|
KEGG: | K03123 | TFIIA2 | transcription initiation factor TFIIA small subunit |
EGGNOG: | 0PPMK | TOA2 | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation (By similarity) |
SGD closest match: | S000001541 | TOA2 | Transcription initiation factor IIA subunit 2 |
CGD closest match: | CAL0000177370 | TOA2 | Transcription initiation factor IIA subunit 2 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_02354_1 | 73.87% | 111 | 1e-60 | MIA_02354_1 |
A0A060T2Z1_BLAAD | 73.64% | 110 | 3e-58 | Transcription initiation factor IIA subunit 2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04928g PE=3 SV=1 |
A0A1E3PEY9_9ASCO | 74.77% | 107 | 2e-56 | Transcription initiation factor IIA subunit 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53127 PE=3 SV=1 |
A0A0J9X8I9_GEOCN | 68.27% | 104 | 7e-50 | Transcription initiation factor IIA subunit 2 OS=Geotrichum candidum GN=BN980_GECA05s06445g PE=3 SV=1 |
UniRef50_H6BRR6 | 60.91% | 110 | 7e-43 | Transcription initiation factor IIA subunit 2 n=42 Tax=Fungi TaxID=4751 RepID=H6BRR6_EXODN |
Q6C0S4_YARLI | 55.45% | 110 | 7e-43 | Transcription initiation factor IIA subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F22136g PE=3 SV=1 |
A0A1E4TC03_9ASCO | 57.52% | 113 | 1e-38 | Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45736 PE=4 SV=1 |
Q5AMM1_CANAL | 47.29% | 129 | 5e-35 | Transcription initiation factor IIA subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOA2 PE=3 SV=1 |
T2AG_YEAST | 44.63% | 121 | 2e-33 | Transcription initiation factor IIA subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOA2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0803
Protein family membership
Domains and repeats
-
Domain
1
20
40
60
80
100
111
Detailed signature matches
-
-
PIRSF009415 (TFIIA_...)
-
-
-
SSF47396 (Transcrip...)
-
-
-
SSF50784 (Transcrip...)
-
-

Unintegrated signatures
Residue annotation
-
TFIIA subunit inte...
-
TFIIA subunit inte...
-
TBP interface cd10...
Protein sequence
>MCA_01808_1 MSNSQYYELYRRSSIGTALTDALDHLISNSMIESQLAVKTLLRFDQVISEQLKEQVKSRCSLKGHLHTYRCCDDVWTFVV KDVNFKMEENETVHAEKIKIVACNSRKTGEQ
GO term prediction
Biological Process
GO:0006367 transcription initiation from RNA polymerase II promoter
Molecular Function
None predicted.
Cellular Component
GO:0005672 transcription factor TFIIA complex