Protein
MIA_02326_1
Length
196 amino acids
Browser: contig03:479312-480084-
Protein function
| EGGNOG: | 0PPXT | CGI121 | Component of the EKC KEOPS complex which promotes both telomere uncapping and telomere elongation (By similarity). The complex is required for efficient recruitment of transcriptional coactivators (By similarity) |
|---|---|---|---|
| SGD closest match: | S000004500 | CGI121 | EKC/KEOPS complex subunit CGI121 |
| CGD closest match: | CAL0000182468 | CGI121 | EKC/KEOPS complex subunit CGI121 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04154_1 | 59.067% | 193 | 2.46e-79 | MCA_04154_1 |
| CG121_YARLI | 46.277% | 188 | 1.47e-50 | EKC/KEOPS complex subunit CGI121 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CGI121 PE=3 SV=1 |
| UniRef50_Q6C7C9 | 46.277% | 188 | 3.42e-47 | EKC/KEOPS complex subunit CGI121 n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=CG121_YARLI |
| A0A0J9XAH0_GEOCN | 42.188% | 192 | 4.77e-48 | Similar to Saccharomyces cerevisiae YML036W CGI121 Component of the EKC/KEOPS complex with Bud32p OS=Geotrichum candidum GN=BN980_GECA07s01880g PE=3 SV=1 |
| A0A1E3PEU5_9ASCO | 42.781% | 187 | 5.33e-47 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52922 PE=3 SV=1 |
| A0A060TEH1_BLAAD | 42.781% | 187 | 3.95e-46 | ARAD1D07370p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D07370g PE=3 SV=1 |
| CG121_YEAST | 31.551% | 187 | 3.56e-27 | EKC/KEOPS complex subunit CGI121 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CGI121 PE=1 SV=1 |
| CG121_CANAL | 41.121% | 107 | 1.79e-19 | EKC/KEOPS complex subunit CGI121 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGI121 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0279
Protein family membership
- CGI121/TPRKB (IPR013926)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_02326_1 MCNQDLQAVIKFPQFSNYLILISLFEDVNNASEIRSQLLQGNPPYEYAFVDTTTIYSLDHLLAAVYRAICDTEAGFLRTR NIHSEVVFCLSPNNNIMDGLRRFGISDNSRSILTVKIIKGSTSADVNDDGNKSLYLPYLDFLIENVKGKQTQVSNLTIEK LTDFKVIKKNYKLPASLIHPTQISNALISAISLRGA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.