Protein

MIA_02326_1

Length
196 amino acids


Browser: contig03:479312-480084-

Protein function

EGGNOG:0PPXTCGI121Component of the EKC KEOPS complex which promotes both telomere uncapping and telomere elongation (By similarity). The complex is required for efficient recruitment of transcriptional coactivators (By similarity)
SGD closest match:S000004500CGI121EKC/KEOPS complex subunit CGI121
CGD closest match:CAL0000182468CGI121EKC/KEOPS complex subunit CGI121

Protein alignments

%idAln lengthE-value
MCA_04154_159.067%1932.46e-79MCA_04154_1
CG121_YARLI46.277%1881.47e-50EKC/KEOPS complex subunit CGI121 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CGI121 PE=3 SV=1
UniRef50_Q6C7C946.277%1883.42e-47EKC/KEOPS complex subunit CGI121 n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=CG121_YARLI
A0A0J9XAH0_GEOCN42.188%1924.77e-48Similar to Saccharomyces cerevisiae YML036W CGI121 Component of the EKC/KEOPS complex with Bud32p OS=Geotrichum candidum GN=BN980_GECA07s01880g PE=3 SV=1
A0A1E3PEU5_9ASCO42.781%1875.33e-47Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52922 PE=3 SV=1
A0A060TEH1_BLAAD42.781%1873.95e-46ARAD1D07370p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D07370g PE=3 SV=1
CG121_YEAST31.551%1873.56e-27EKC/KEOPS complex subunit CGI121 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CGI121 PE=1 SV=1
CG121_CANAL41.121%1071.79e-19EKC/KEOPS complex subunit CGI121 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CGI121 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0279

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF143870 (PF0523-like)
    2. PF08617 (CGI-121)

Protein sequence

>MIA_02326_1
MCNQDLQAVIKFPQFSNYLILISLFEDVNNASEIRSQLLQGNPPYEYAFVDTTTIYSLDHLLAAVYRAICDTEAGFLRTR
NIHSEVVFCLSPNNNIMDGLRRFGISDNSRSILTVKIIKGSTSADVNDDGNKSLYLPYLDFLIENVKGKQTQVSNLTIEK
LTDFKVIKKNYKLPASLIHPTQISNALISAISLRGA

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.